KEGG   Cellulophaga lytica DSM 7489: Celly_2325Help
Entry
Celly_2325        CDS       T01434                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celly_2325
   01230 Biosynthesis of amino acids
    Celly_2325
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_2325
   00051 Fructose and mannose metabolism
    Celly_2325
   00562 Inositol phosphate metabolism
    Celly_2325
Enzymes [BR:cly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celly_2325
Exosome [BR:cly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celly_2325
  Exosomal proteins of bladder cancer cells
   Celly_2325
  Exosomal proteins of melanoma cells
   Celly_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2592900..2593649
Genome map
AA seq 249 aa AA seqDB search
MRAKIVAGNWKMNKTLTETNALLAELSGKLPDTDAEVMVAPTYVNLAAAVEDVKSSTIQV
IAQNMHFADNGAYTGEISADMLLDIGINTVIIGHSERRAYFGETDEILAKKVIKALEKNL
RVVFCFGEELEDRKSDNHFNIVASQLKNALFNLKPEAWSNIVLAYEPVWAIGTGETASPE
QAQEMHAFIRKTIADEYTTEIAEAVSILYGGSVKPANAREIFSKADVDGGLIGGAALKAD
DFIAIIDAI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaaaaatagttgcaggtaactggaaaatgaataaaaccctaaccgaaacaaat
gcattgttagcagaattatctggtaaattaccagacacagatgcagaggttatggtagca
ccaacgtatgtaaatttagcagcggcagtagaagacgtaaaatcatcaacaatacaagta
attgcacaaaatatgcactttgcagataatggtgcatatacaggagaaatttctgcagat
atgttgttagatattggcataaacactgtaattattggtcactctgaacgtagagcttat
tttggcgaaactgatgaaatcttagctaaaaaagtaattaaagcgttagaaaagaattta
cgcgttgttttttgttttggtgaagagttagaagaccgtaagtcagacaaccactttaat
attgtggcgtctcaattaaaaaatgctctttttaatttaaagccagaagcttggtctaac
attgttttagcctatgagcctgtatgggcaattggtacaggtgaaactgcatctccagaa
caagcacaagaaatgcacgcatttattagaaaaacaatagcagatgagtatactacagaa
attgcagaagctgtatctattttatacggtggtagtgtaaaacctgcaaatgctagagaa
attttttctaaagcagatgtagatggtggcttaattggtggagcagcactaaaagcagac
gattttattgctattatagacgcaatataa

DBGET integrated database retrieval system