KEGG   Cellulophaga lytica: Celly_2337Help
Entry
Celly_2337        CDS       T01434                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cly  Cellulophaga lytica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Celly_2337
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celly_2337
Enzymes [BR:cly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Celly_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2607054..2609333
Genome map
AA seq 759 aa AA seqDB search
MFGCTTKKEKKFTEEEINIIPKPVFTELHKGSFSFNGNTKLVASTKNEQKLLASFSQKFK
QVSGVKLAVVASAPSSNFLQFKIVDSLPYEGYNLVINSNHITVSAKTYSGFVYGLETIKQ
LLPASIESANFVQKEWVVPAIEIKDNPRFKWRGLMLDVSRHFFEVDYIKKTLDRMAMLKM
NTFHWHLVDDQGWRIEIKKYPKLTSVGGYRVNQEDKGWNARPNAPLGTKATYGGFYTQEQ
IKEVVAYAKERGITVVPEIEMPAHVSSAIAAYPEFSCLGEQIMVPSGGVWPITDIYCAGK
EETFTFLEDVLTEVMELFPSKYIHIGGDEATKTNWKTCTHCTSRLQTEDLANVDELQSYF
IKRIERFISSKNRVLIGWDEILEGGLAPGATVMSWRGVKGGLEASAEGHNVVMTPGTHCY
FDHYQGNQDQEPLAFGGYTPLSKVYEFNPVVDKMTPEQEKHVLGGQANLWAEYIPTEQQS
EYMIFPRLAAMSEALWTPTTHKNWANFSGRVKELFKRYDVMGVNYAKSAYQVTTDTKVDI
EKGELSILLKNEFPDSDIRYSVDGSLLSQSSSQYQNTIQLNKTATLKAAMFKNNKQVGPT
LTKEFNYHNAVGKYVVYNTKYHKNYQGEQQLGLVNVLRGSKNFHDGQWQGWLGNNMDVVI
DFDVETAFSAVTVGTLENQSSGIYFPLKIEVFTSEHRKKFTKVAEVTRPFKVSNASELKD
FKINFKPTKARYIKVVVTNLKSPPNGGGAWLFVDEIIVE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttgtacaactaaaaaagaaaaaaaatttacagaagaagaaattaatattatt
cctaagcctgtatttacagagttacataaaggtagttttagttttaatggaaatacaaaa
ttggttgcaagcacaaaaaatgaacaaaaattattagcgtctttttctcaaaagtttaaa
caagtctcaggtgtaaaattagctgtggtagctagtgctccttcttctaattttttacag
tttaaaattgtagattcattaccttatgaaggctataatttagtaattaattctaatcat
ataaccgtatctgcaaaaacgtattctggttttgtatatggattagaaactataaaacag
ttacttcctgctagtatagagagtgcaaactttgtgcaaaaagagtgggtagttccagca
atagaaattaaagataatcctcgttttaaatggcgcggactaatgttagatgtgtctaga
catttttttgaggtagattatattaaaaaaacgttagaccgtatggcaatgctaaaaatg
aatacatttcattggcatttggtagatgatcaaggatggagaatagaaattaaaaaatat
ccaaaactaacgtctgttggtggttatagggtaaaccaagaggataaaggatggaacgct
agaccaaatgcacctttaggaacaaaagctacttacggaggtttttatacgcaagagcaa
ataaaagaagtagtagcctatgcaaaagaaagaggtataactgtagtgccagaaatagaa
atgccagcacacgttagtagtgcaatagctgcatacccagagttttcttgtttaggagag
caaattatggttccgtctggtggtgtttggccaattacagatatttactgtgctggtaag
gaagaaacatttacttttttagaagatgtattaacagaggttatggagttgtttccgtct
aaatatatacacattggcggagatgaagctacaaaaaccaattggaaaacttgtacacat
tgtacctctagattacaaacagaagacttagcaaatgtagatgaattgcagagctatttt
attaaaagaatagaacgttttataagttctaaaaatagggttttaattggttgggatgaa
attttagagggcggtttggctccaggagcaaccgttatgagttggcgtggtgtaaagggc
ggtctagaggcatctgcagaggggcataatgttgtaatgacacctggtacgcattgttat
tttgatcattaccaaggaaatcaagatcaagaacctttagcatttggtggttatactccg
cttagcaaagtatatgagtttaacccagtggtagataaaatgactccagagcaggaaaaa
cacgtgttaggcggacaagcaaatttgtgggcagagtatataccaacagaacaacagtcc
gagtatatgatatttcctagactggctgctatgtctgaggctctgtggacaccaacgaca
cataaaaactgggctaatttttcaggtagagtaaaagagctgtttaagcgttatgatgtt
atgggtgttaactatgctaaaagtgcttatcaggtaactacagatactaaagttgatata
gaaaaaggtgaattatcaatcttattaaaaaatgaatttccagattcagatattagatac
tccgtagatggttctttgctttcacagtcatcttcacaatatcaaaatacaattcaacta
aataaaacagctacgttaaaggctgcaatgtttaaaaataataaacaagtagggccaacc
ttaactaaagagtttaattaccataatgcggttggtaaatatgtggtttataacactaag
tatcataaaaattaccaaggagagcaacagcttggtttggtaaatgtattaagaggatct
aaaaattttcacgacggacagtggcaaggttggttgggtaataatatggatgtggtaata
gattttgatgtagaaacagcgttttctgcagtaacagttggtacactagaaaatcaaagt
tcaggaatttattttcctttaaaaatagaagtctttacatcagaacatagaaaaaagttt
accaaagttgcagaggttactagaccatttaaagtaagcaatgcatcagaattaaaagat
tttaaaatcaattttaaaccaactaaagctaggtacataaaggtggtggtaactaattta
aaaagtccgcctaatggcggtggtgcttggttgtttgtagatgaaattattgtagaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system