KEGG   Cellulophaga lytica: Celly_2337Help
Entry
Celly_2337        CDS       T01434                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cly  Cellulophaga lytica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cly00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cly00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2607054..2609333
Genome map
AA seq 759 aa AA seqDB search
MFGCTTKKEKKFTEEEINIIPKPVFTELHKGSFSFNGNTKLVASTKNEQKLLASFSQKFK
QVSGVKLAVVASAPSSNFLQFKIVDSLPYEGYNLVINSNHITVSAKTYSGFVYGLETIKQ
LLPASIESANFVQKEWVVPAIEIKDNPRFKWRGLMLDVSRHFFEVDYIKKTLDRMAMLKM
NTFHWHLVDDQGWRIEIKKYPKLTSVGGYRVNQEDKGWNARPNAPLGTKATYGGFYTQEQ
IKEVVAYAKERGITVVPEIEMPAHVSSAIAAYPEFSCLGEQIMVPSGGVWPITDIYCAGK
EETFTFLEDVLTEVMELFPSKYIHIGGDEATKTNWKTCTHCTSRLQTEDLANVDELQSYF
IKRIERFISSKNRVLIGWDEILEGGLAPGATVMSWRGVKGGLEASAEGHNVVMTPGTHCY
FDHYQGNQDQEPLAFGGYTPLSKVYEFNPVVDKMTPEQEKHVLGGQANLWAEYIPTEQQS
EYMIFPRLAAMSEALWTPTTHKNWANFSGRVKELFKRYDVMGVNYAKSAYQVTTDTKVDI
EKGELSILLKNEFPDSDIRYSVDGSLLSQSSSQYQNTIQLNKTATLKAAMFKNNKQVGPT
LTKEFNYHNAVGKYVVYNTKYHKNYQGEQQLGLVNVLRGSKNFHDGQWQGWLGNNMDVVI
DFDVETAFSAVTVGTLENQSSGIYFPLKIEVFTSEHRKKFTKVAEVTRPFKVSNASELKD
FKINFKPTKARYIKVVVTNLKSPPNGGGAWLFVDEIIVE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttgtacaactaaaaaagaaaaaaaatttacagaagaagaaattaatattatt
cctaagcctgtatttacagagttacataaaggtagttttagttttaatggaaatacaaaa
ttggttgcaagcacaaaaaatgaacaaaaattattagcgtctttttctcaaaagtttaaa
caagtctcaggtgtaaaattagctgtggtagctagtgctccttcttctaattttttacag
tttaaaattgtagattcattaccttatgaaggctataatttagtaattaattctaatcat
ataaccgtatctgcaaaaacgtattctggttttgtatatggattagaaactataaaacag
ttacttcctgctagtatagagagtgcaaactttgtgcaaaaagagtgggtagttccagca
atagaaattaaagataatcctcgttttaaatggcgcggactaatgttagatgtgtctaga
catttttttgaggtagattatattaaaaaaacgttagaccgtatggcaatgctaaaaatg
aatacatttcattggcatttggtagatgatcaaggatggagaatagaaattaaaaaatat
ccaaaactaacgtctgttggtggttatagggtaaaccaagaggataaaggatggaacgct
agaccaaatgcacctttaggaacaaaagctacttacggaggtttttatacgcaagagcaa
ataaaagaagtagtagcctatgcaaaagaaagaggtataactgtagtgccagaaatagaa
atgccagcacacgttagtagtgcaatagctgcatacccagagttttcttgtttaggagag
caaattatggttccgtctggtggtgtttggccaattacagatatttactgtgctggtaag
gaagaaacatttacttttttagaagatgtattaacagaggttatggagttgtttccgtct
aaatatatacacattggcggagatgaagctacaaaaaccaattggaaaacttgtacacat
tgtacctctagattacaaacagaagacttagcaaatgtagatgaattgcagagctatttt
attaaaagaatagaacgttttataagttctaaaaatagggttttaattggttgggatgaa
attttagagggcggtttggctccaggagcaaccgttatgagttggcgtggtgtaaagggc
ggtctagaggcatctgcagaggggcataatgttgtaatgacacctggtacgcattgttat
tttgatcattaccaaggaaatcaagatcaagaacctttagcatttggtggttatactccg
cttagcaaagtatatgagtttaacccagtggtagataaaatgactccagagcaggaaaaa
cacgtgttaggcggacaagcaaatttgtgggcagagtatataccaacagaacaacagtcc
gagtatatgatatttcctagactggctgctatgtctgaggctctgtggacaccaacgaca
cataaaaactgggctaatttttcaggtagagtaaaagagctgtttaagcgttatgatgtt
atgggtgttaactatgctaaaagtgcttatcaggtaactacagatactaaagttgatata
gaaaaaggtgaattatcaatcttattaaaaaatgaatttccagattcagatattagatac
tccgtagatggttctttgctttcacagtcatcttcacaatatcaaaatacaattcaacta
aataaaacagctacgttaaaggctgcaatgtttaaaaataataaacaagtagggccaacc
ttaactaaagagtttaattaccataatgcggttggtaaatatgtggtttataacactaag
tatcataaaaattaccaaggagagcaacagcttggtttggtaaatgtattaagaggatct
aaaaattttcacgacggacagtggcaaggttggttgggtaataatatggatgtggtaata
gattttgatgtagaaacagcgttttctgcagtaacagttggtacactagaaaatcaaagt
tcaggaatttattttcctttaaaaatagaagtctttacatcagaacatagaaaaaagttt
accaaagttgcagaggttactagaccatttaaagtaagcaatgcatcagaattaaaagat
tttaaaatcaattttaaaccaactaaagctaggtacataaaggtggtggtaactaattta
aaaagtccgcctaatggcggtggtgcttggttgtttgtagatgaaattattgtagaatag

DBGET integrated database retrieval system