KEGG   Cellulophaga lytica DSM 7489: Celly_2532Help
Entry
Celly_2532        CDS       T01434                                 

Definition
magnesium chelatase subunit Chll
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celly_2532
Enzymes [BR:cly01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Celly_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2890397..2891863
Genome map
AA seq 488 aa AA seqDB search
MKIDTIKTLGDLKKAGYQSKSIKDELRDNLIEKVKNKEATFTGIHGYQNTVIPELERAIL
SRHNINLLGLRGQAKTRLARLMLNLLDEYIPVVKGSEINDDPLQPISRYAVELIKEEGDN
TPITWLHRSERFAEKLATPDVTVADIIGDVDPIKAANLKLSYADDRVIHYGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDMQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPEDIETAKIITAQEAKLDSRQSEAVMVPELAKELLEQIVFEARKSEYI
DAKSGVSARLSITAFENLLSTAELRALKTGDDKTTVRLSDFIGIIPAITGKVELVYEGEQ
EGAASVAYNLIGDAVQTLFPEYFPKIEKLKKQEDVSPYDSVVSWFFNNEAGFELLDDLRD
KEYKNMLDAVSPLDDLLGEHQPKLKKEESYFVKEFILWGLVQFKQLSKYRFTEGIQFKDP
YSSYISGL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagatacaattaaaacactaggcgatttaaaaaaagctggataccaaagtaaa
tctataaaagatgagttacgagataatttaatagaaaaagttaaaaataaagaagcaaca
tttacaggtattcacgggtatcaaaatactgttataccagaattagagcgtgctatactt
tctagacataacataaacttattgggtttacgtgggcaagcaaaaactcgtttggctagg
ttaatgcttaatttactagatgaatatataccagtggtaaaaggatctgaaattaatgac
gatcccttacaaccaatttctagatatgctgtagaacttattaaagaagagggagacaat
acacccattacttggctacacagaagtgaacgttttgcagaaaaattagcaacaccagat
gttactgttgcagatattattggagatgtagaccctataaaagcagccaatttaaaactt
agttatgctgatgatagagtaatacattacggaatgataccacgtgctaaccgttgtatt
tttgttattaatgagctaccagatttacaagcaagaatacaagttgcactatttaatatt
ttacaagaaggagatatacaaattagaggttttaaattacgtttgcctttagatatgcaa
tttgtttttacagcaaatccagaagattatacaaatcgtggtagtattgttacgccgtta
aaagacagaataggctcacagattttaactcattatccagaagacatagaaactgctaaa
attattacagcacaagaagctaagttagatagtagacagtctgaggctgttatggttcca
gaactagcaaaagaactgttagaacaaattgtttttgaagctcgtaaaagcgaatatata
gatgctaaaagtggtgtaagtgcaaggttaagcattactgcttttgaaaacttattaagt
acagcagagcttagagctttaaaaactggtgatgataaaacaacagttagacttagtgat
tttataggcattataccagcaataactggtaaggtagagttggtttatgaaggtgagcaa
gaaggtgcagcaagtgtggcttataacctaattggtgatgcggtacaaacattgtttcca
gagtattttcctaaaattgaaaaacttaaaaaacaagaagatgttagtccgtatgacagt
gtagtgtcttggttttttaataacgaagctggttttgagcttttagatgatttaagagat
aaagagtataaaaatatgttagatgccgtttctcctttagatgatttgttaggggagcac
cagcctaagttaaaaaaagaagaaagttattttgtaaaagagtttatactttggggcttg
gtacagtttaagcaattaagcaaatacagatttacagaaggtatacagtttaaagatcct
tatagtagttatataagcggtttgtaa

DBGET integrated database retrieval system