KEGG   Cellulophaga lytica DSM 7489: Celly_2597Help
Entry
Celly_2597        CDS       T01434                                 

Definition
(GenBank) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celly_2597
   01230 Biosynthesis of amino acids
    Celly_2597
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_2597
   00030 Pentose phosphate pathway
    Celly_2597
   00051 Fructose and mannose metabolism
    Celly_2597
   00052 Galactose metabolism
    Celly_2597
  Energy metabolism
   00680 Methane metabolism
    Celly_2597
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Celly_2597
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celly_2597
Protein phosphatases and associated proteins [BR:cly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celly_2597
Messenger RNA biogenesis [BR:cly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Celly_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2974656..2975642
Genome map
AA seq 328 aa AA seqDB search
MASKIKKIAVFTSGGDSPGMNAAIRSVVRTCAYLKVECVGIYRGYEGMVEGDFKPMDARS
VNNIINKGGTILKSARSDSFRTPEGRKQAYDNLVANNIDAFVVIGGDGSFTGAMIFNKEY
DFPVIGIPGTIDNDIFGTTYTLGFDTALNTVVDAIDKIRDTASSHNRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENLGLERLLESLKRSKKSGKSSSIVIVAEGDKTGKNVFELKE
YVEENLPIYDVRVSVLGHMQRGGTPSCFDRVLASRMGVRAVEALLEGKSNLMVGIQDNKL
ILTPIEQAIKGHTKIDKELIRVSDIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaaattaaaaaaatagcagtatttacttctggaggagattctccaggaatg
aacgcagcaattagatctgtagtacgtacttgtgcttatttaaaagttgagtgtgtaggt
atttatagagggtatgaaggtatggttgaaggagactttaaaccaatggatgcccgtagt
gtaaataacattattaataaaggtggtactatattaaagtctgcacgttcagattctttt
agaacaccagaaggtcgtaagcaagcttatgataatcttgtagctaacaatatagatgct
tttgttgtaattggtggtgatggtagctttaccggagcaatgatatttaataaggaatat
gattttcctgtaataggcatacctggtactatagataacgatatttttggcacaacctat
actttaggttttgatacagctttaaacacagttgtagacgctatagataaaattagagat
acagctagttctcataacagacttttctttgtagaagttatgggtagggatgttgggcat
attgcacttaatgcaggtgttggagcaggagcagaagaaatattaataccagaagaaaac
cttggtttagagcgtttgttagagtctttaaaacgaagcaaaaaatctggtaaatcttct
agtattgtaattgttgcagaaggagataaaacgggtaaaaatgtttttgaacttaaagaa
tatgtagaagaaaatttaccaatatatgatgtgcgtgtatctgtactaggtcatatgcaa
cgtggaggaacaccttcttgttttgatcgtgtattggcaagtagaatgggggtaagggct
gtagaagctttgttagaaggtaaaagcaacttaatggttggtatacaagacaacaagtta
atacttacaccaatagaacaagctataaagggacacacaaaaatagataaagaactcatt
agagtttcagacataatgtcaacataa

DBGET integrated database retrieval system