KEGG   Cellulophaga lytica DSM 7489: Celly_2597Help
Entry
Celly_2597        CDS       T01434                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00010  Glycolysis / Gluconeogenesis
cly00030  Pentose phosphate pathway
cly00051  Fructose and mannose metabolism
cly00052  Galactose metabolism
cly00680  Methane metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01120  Microbial metabolism in diverse environments
cly01130  Biosynthesis of antibiotics
cly01200  Carbon metabolism
cly01230  Biosynthesis of amino acids
cly03018  RNA degradation
Module
cly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_2597
   00030 Pentose phosphate pathway
    Celly_2597
   00051 Fructose and mannose metabolism
    Celly_2597
   00052 Galactose metabolism
    Celly_2597
  Energy metabolism
   00680 Methane metabolism
    Celly_2597
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Celly_2597
Enzymes [BR:cly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celly_2597
Protein phosphatases and associated proteins [BR:cly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celly_2597
Messenger RNA biogenesis [BR:cly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Celly_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADY30414
JGI: Celly_2597
UniProt: F0RIS0
Position
2974656..2975642
Genome map
AA seq 328 aa AA seqDB search
MASKIKKIAVFTSGGDSPGMNAAIRSVVRTCAYLKVECVGIYRGYEGMVEGDFKPMDARS
VNNIINKGGTILKSARSDSFRTPEGRKQAYDNLVANNIDAFVVIGGDGSFTGAMIFNKEY
DFPVIGIPGTIDNDIFGTTYTLGFDTALNTVVDAIDKIRDTASSHNRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENLGLERLLESLKRSKKSGKSSSIVIVAEGDKTGKNVFELKE
YVEENLPIYDVRVSVLGHMQRGGTPSCFDRVLASRMGVRAVEALLEGKSNLMVGIQDNKL
ILTPIEQAIKGHTKIDKELIRVSDIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaaattaaaaaaatagcagtatttacttctggaggagattctccaggaatg
aacgcagcaattagatctgtagtacgtacttgtgcttatttaaaagttgagtgtgtaggt
atttatagagggtatgaaggtatggttgaaggagactttaaaccaatggatgcccgtagt
gtaaataacattattaataaaggtggtactatattaaagtctgcacgttcagattctttt
agaacaccagaaggtcgtaagcaagcttatgataatcttgtagctaacaatatagatgct
tttgttgtaattggtggtgatggtagctttaccggagcaatgatatttaataaggaatat
gattttcctgtaataggcatacctggtactatagataacgatatttttggcacaacctat
actttaggttttgatacagctttaaacacagttgtagacgctatagataaaattagagat
acagctagttctcataacagacttttctttgtagaagttatgggtagggatgttgggcat
attgcacttaatgcaggtgttggagcaggagcagaagaaatattaataccagaagaaaac
cttggtttagagcgtttgttagagtctttaaaacgaagcaaaaaatctggtaaatcttct
agtattgtaattgttgcagaaggagataaaacgggtaaaaatgtttttgaacttaaagaa
tatgtagaagaaaatttaccaatatatgatgtgcgtgtatctgtactaggtcatatgcaa
cgtggaggaacaccttcttgttttgatcgtgtattggcaagtagaatgggggtaagggct
gtagaagctttgttagaaggtaaaagcaacttaatggttggtatacaagacaacaagtta
atacttacaccaatagaacaagctataaagggacacacaaaaatagataaagaactcatt
agagtttcagacataatgtcaacataa

DBGET integrated database retrieval system