KEGG   Cellulophaga lytica DSM 7489: Celly_2958Help
Entry
Celly_2958        CDS       T01434                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
cly00340  Histidine metabolism
cly01100  Metabolic pathways
cly01110  Biosynthesis of secondary metabolites
cly01230  Biosynthesis of amino acids
Module
cly_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Celly_2958
Enzymes [BR:cly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Celly_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Phage_TTP_13
Motif
Other DBs
NCBI-ProteinID: ADY30775
JGI: Celly_2958
UniProt: F0RCP3
Position
complement(3375685..3376968)
Genome map
AA seq 427 aa AA seqDB search
MNKIDNPAVADWKQVLERPTQTVADIEGTVVSVFNEVRTDGDKAVNKYTTKFDGVSLQST
IVSVEELVEAEKLVSEELKKAIQLAKSNIEAFHKAQETSKVSIQTVNGVDCWQEKRPIQK
VGLYIPGGTAPLFSTILMLATPANIAGCKEIVLCSPPNKEGKINPAILYAANLCGVTKIY
KVGGIQAIAAMTFGTQTIPQVYKIFGPGNQFVTVAKQIATKYGVAIDMPAGPSELLVLAD
DTANAAFVASDLLSQAEHGTDSQVILVSTSKQMISDVETELEKQLAVLPRVEIATQAIAN
SKLIYIETLETAMQLINEYAPEHFIVCVENEDYVLNTIENAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFTKSITFQKISEQGIKEIGEAIELMADAEGLQAHKNAVT
LRLKSLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataagattgataatccagctgttgcagattggaagcaagttttagaaagaccaaca
caaactgttgcagatatagaaggtactgtagtttctgtttttaatgaggttagaactgat
ggtgataaagctgtaaataagtacactactaagtttgatggtgtttctttgcaatctact
attgtcagtgttgaagaattggttgaagcagaaaaattagtatcagaagaactaaaaaaa
gcaatacaattagcaaaaagtaatattgaagcttttcataaggcacaagagacgagtaag
gtaagtatacaaacagtaaacggagtagattgttggcaagaaaaacgaccaattcaaaaa
gttggtttatacattcctggtggtactgcaccattattttctacaatactaatgttggca
acaccagcaaacatagcaggttgtaaagaaattgtattgtgttctcctccaaacaaagaa
ggcaaaattaatcccgctattttgtatgcagcaaatttatgtggtgtaactaaaatatat
aaagttggtggtatacaagctattgcagctatgacgtttggtacacaaacaataccacaa
gtttataaaatatttggtccaggcaaccaatttgttaccgtagctaaacaaatagcaacc
aaatatggtgtagctatagatatgccagcaggaccaagtgaattgttagttttagcagat
gatacagctaatgcagcatttgtagcatcagacttattaagtcaggcagaacacggtaca
gatagtcaagtgatattagtatctacttcaaaacaaatgatttctgacgtagaaactgag
ttagaaaagcaattagcagttttaccacgtgtagaaatagcaacacaggccatagcaaat
agtaagcttatatacatagaaacgctagaaacggctatgcaattgattaatgaatatgct
ccagagcactttatagtttgtgtagaaaatgaggattatgtattaaacacaattgaaaat
gctgggtctgtatttattggcaattatacgccagagagtgcaggtgattatgcatcggga
accaaccatactttaccaacaaacggttatgcaaaacaatacagtggtgttaatttagat
agttttaccaagagtattacgtttcaaaaaatatctgaacaaggtataaaagaaataggt
gaagctatagagttaatggcagatgcagaaggtttacaagcacacaaaaatgcagttaca
ttacgtttaaagagtttaaaataa

DBGET integrated database retrieval system