KEGG   Cellulophaga lytica DSM 7489: Celly_3166Help
Entry
Celly_3166        CDS       T01434                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celly_3166
Enzymes [BR:cly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Celly_3166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3620087..3620773
Genome map
AA seq 228 aa AA seqDB search
MSIDTINLASISNNISVEDIGDDHLFTGLETPLRPDAFALSDEEKKEKIENLFGQIMDVM
GLDLTDDSLQGTPKRVAKMYIDEIFCGLNPKNKPKIALFENKYQYNQILVEKNITFYSNC
EHHFVPIIGKAHVAYKSSGNVIGLSKLNRIVQYYAKRPQVQERLTNQIGVELQKILNTED
VAVIIDAKHLCVASRGVKDDTSTTVTAFYGGEFNNATKITEIQNYLKH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagatacaataaatttagcaagcatttctaacaatatctctgtagaagatatt
ggagacgatcacttgtttacaggtttagaaacacctttaagaccagatgcttttgcattg
tctgatgaagaaaaaaaggaaaaaatagaaaacctttttgggcaaattatggacgttatg
ggcttagatttaacagacgattctttgcaaggaacaccaaaacgtgttgcaaaaatgtac
attgatgaaattttttgtggtttaaaccctaaaaataagccaaaaattgctttatttgaa
aataaataccaatataaccaaatacttgttgaaaaaaacattactttttactctaattgt
gagcatcattttgttccaattattggcaaagcacatgtagcgtacaaatcttctggcaat
gtaataggcttgtctaaattaaacagaattgtacaatactacgctaaaagaccacaagtt
caagagcgcttaaccaaccaaattggcgtggagctccaaaaaatattaaatacagaagac
gttgctgtcattatagatgccaaacatttatgtgtagcatctagaggtgtaaaagatgac
acctctacaacagtaactgctttttatggtggtgagtttaacaacgccacaaaaataaca
gaaatacaaaactatttaaaacattaa

DBGET integrated database retrieval system