KEGG   Cellulophaga lytica: Celly_3174Help
Entry
Celly_3174        CDS       T01434                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cly  Cellulophaga lytica
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cly00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cly00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3623980..3625287)
Genome map
AA seq 435 aa AA seqDB search
MGTFKIEGGQRLQGEITPQGAKNEALQILCAVLLTPEEVQINNIPDIVDVNKLIALLEDL
GVKIQKRGKGSYTFKADDVNLDYLQSDQFKEDGRGLRGSIMLVGPLLARFGKGYIPKPGG
DKIGRRRLDTHFEGFINLGAKFRYNKEEYFYGVEADKLKGTYMLLDEASVTGTANIVMAA
VLAEGTTTIYNAACEPYLQQLCKMLNRMGAKITGVGSNLLVIEGVDELGGTEHRMLPDMI
EIGSWIGLAAMTKSELTIKNVSWDDLGQIPTVFRKLGITLERKGDDIYIPEHKDGYEIQN
YIDGSILTIADAPWPGLTPDLLSIILVVATQARGEVLIHQKMFESRLFFVDKLLDMGAKV
ILCDPHRATVIGHDFKSTLKATTMVSPDIRAGVSLLIAALSAKGTSTIHNIEQIDRGYEN
IDERLRAIGAKITRV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggggacatttaaaattgaaggcggtcaacgtctgcaaggagaaattactccgcaagga
gcaaaaaacgaagcattacaaatactatgtgcggtattattaacaccagaagaggtgcaa
attaataacataccagatattgtagatgtaaataaacttatagctttattagaagatttg
ggtgtgaaaatccagaaaagaggtaaaggatcttacacctttaaggcagatgatgtaaat
ttagattacttacagtcagaccaatttaaggaagatggtcgtggtttacgtggttctatt
atgcttgttgggccgttattagcacgttttggtaaaggatacataccaaagccaggcgga
gataaaattggccgtagaagattagatacgcattttgaaggttttattaacctaggcgct
aaatttagatacaataaagaagagtatttttacggagtagaggcagataagttaaaaggt
acttacatgcttttagatgaagcctctgtaacaggaacagcaaacatagtaatggcagct
gttttagcagaaggaacaactacaatatacaacgcagcctgtgaaccatatttacaacag
ctatgtaaaatgcttaaccgtatgggggcaaaaattacaggtgtaggctctaatttattg
gttattgaaggtgtagatgagcttggaggtacagaacacagaatgttaccagatatgatt
gaaattggtagctggattggtcttgctgctatgacaaaaagtgagcttactattaaaaat
gttagttgggatgatcttgggcaaataccaactgtatttagaaaattaggtattacacta
gaacgtaaaggtgatgatatttatataccagagcataaagatgggtatgaaatacaaaat
tatatagatggttctattttaacaattgcagatgcaccttggccaggcttaacaccagat
ttgttaagtattatattagttgtagctacacaggcaagaggtgaagtgttaatacaccaa
aaaatgtttgaaagccgtttgttttttgtagataaattactagatatgggagcaaaagtt
attttgtgtgatccgcacagggcaacagttattggtcacgattttaaatctacattaaaa
gcaacaacaatggtgtctccagatattagagcaggggtatctttgttaattgctgcatta
tctgcaaaaggaacctctacaatacacaacatagaacaaatagaccgaggttatgaaaat
atagacgagcgtttaagagctattggagcaaaaattacgcgagtttaa

DBGET integrated database retrieval system