KEGG   Cellulophaga lytica: Celly_3300Help
Entry
Celly_3300        CDS       T01434                                 

Definition
haloacid dehalogenase domain-containing protein hydrolase
Orthology
K07025  
putative hydrolase of the HAD superfamily
Organism
cly  Cellulophaga lytica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3763270..3763872
Genome map
AA seq 200 aa AA seqDB search
MIKNIIFDFGDIFINLNKTATALELSKFGFTKISPELDVLMKNYEKGLISSDDFINKTNK
IFPTATPQELKNAWNKIILDFPEERLLFIETLAKEKNYRLFLLSNTNELHIEQVIKNMGT
ERYDRFKACFEQFYLSHLINFRKPNANIYEFVLKENNLNAKETFFIDDTEENTIAAEKLG
IKSWNLQVGNEDIINLKSKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatataatttttgattttggcgatatttttattaacctaaacaaaacagct
accgcattagaattaagtaaatttggctttactaaaattagccctgagttagacgtatta
atgaagaattatgaaaaggggttaatttcttctgatgattttataaataaaacaaacaaa
atttttcctactgccacaccacaagaacttaaaaatgcttggaataaaattattttagat
ttccctgaagaacgtttactatttatagaaacattagctaaagagaaaaattaccgttta
tttttgcttagcaatacaaatgaattacatatagagcaggttattaaaaatatgggaact
gaaagatatgatagatttaaagcttgttttgagcaattttacttgtcccatttaattaat
tttagaaaacctaatgctaatatttacgagtttgtattaaaagaaaacaacttaaatgct
aaagaaactttttttattgatgacacagaagaaaatacaattgctgcagaaaaattagga
attaaaagctggaatttgcaagttggcaatgaagacatcatcaacctaaagagtaaatta
tag

DBGET integrated database retrieval system