KEGG   Cellulophaga lytica DSM 7489: Celly_3300Help
Entry
Celly_3300        CDS       T01434                                 

Definition
(GenBank) Haloacid dehalogenase domain protein hydrolase
  KO
K07025  
putative hydrolase of the HAD superfamily
Organism
cly  Cellulophaga lytica DSM 7489
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3763270..3763872
Genome map
AA seq 200 aa AA seqDB search
MIKNIIFDFGDIFINLNKTATALELSKFGFTKISPELDVLMKNYEKGLISSDDFINKTNK
IFPTATPQELKNAWNKIILDFPEERLLFIETLAKEKNYRLFLLSNTNELHIEQVIKNMGT
ERYDRFKACFEQFYLSHLINFRKPNANIYEFVLKENNLNAKETFFIDDTEENTIAAEKLG
IKSWNLQVGNEDIINLKSKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatataatttttgattttggcgatatttttattaacctaaacaaaacagct
accgcattagaattaagtaaatttggctttactaaaattagccctgagttagacgtatta
atgaagaattatgaaaaggggttaatttcttctgatgattttataaataaaacaaacaaa
atttttcctactgccacaccacaagaacttaaaaatgcttggaataaaattattttagat
ttccctgaagaacgtttactatttatagaaacattagctaaagagaaaaattaccgttta
tttttgcttagcaatacaaatgaattacatatagagcaggttattaaaaatatgggaact
gaaagatatgatagatttaaagcttgttttgagcaattttacttgtcccatttaattaat
tttagaaaacctaatgctaatatttacgagtttgtattaaaagaaaacaacttaaatgct
aaagaaactttttttattgatgacacagaagaaaatacaattgctgcagaaaaattagga
attaaaagctggaatttgcaagttggcaatgaagacatcatcaacctaaagagtaaatta
tag

DBGET integrated database retrieval system