KEGG   Cellulophaga lytica DSM 7489: Celly_3300Help
Entry
Celly_3300        CDS       T01434                                 

Definition
(GenBank) Haloacid dehalogenase domain protein hydrolase
  KO
K20866  
glucose-1-phosphatase [EC:3.1.3.10]
Organism
cly  Cellulophaga lytica DSM 7489
Pathway
Glycolysis / Gluconeogenesis
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celly_3300
Enzymes [BR:cly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Celly_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3763270..3763872
Genome map
AA seq 200 aa AA seqDB search
MIKNIIFDFGDIFINLNKTATALELSKFGFTKISPELDVLMKNYEKGLISSDDFINKTNK
IFPTATPQELKNAWNKIILDFPEERLLFIETLAKEKNYRLFLLSNTNELHIEQVIKNMGT
ERYDRFKACFEQFYLSHLINFRKPNANIYEFVLKENNLNAKETFFIDDTEENTIAAEKLG
IKSWNLQVGNEDIINLKSKL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaatataatttttgattttggcgatatttttattaacctaaacaaaacagct
accgcattagaattaagtaaatttggctttactaaaattagccctgagttagacgtatta
atgaagaattatgaaaaggggttaatttcttctgatgattttataaataaaacaaacaaa
atttttcctactgccacaccacaagaacttaaaaatgcttggaataaaattattttagat
ttccctgaagaacgtttactatttatagaaacattagctaaagagaaaaattaccgttta
tttttgcttagcaatacaaatgaattacatatagagcaggttattaaaaatatgggaact
gaaagatatgatagatttaaagcttgttttgagcaattttacttgtcccatttaattaat
tttagaaaacctaatgctaatatttacgagtttgtattaaaagaaaacaacttaaatgct
aaagaaactttttttattgatgacacagaagaaaatacaattgctgcagaaaaattagga
attaaaagctggaatttgcaagttggcaatgaagacatcatcaacctaaagagtaaatta
tag

DBGET integrated database retrieval system