KEGG   Caldivirga maquilingensis: Cmaq_0078Help
Entry
Cmaq_0078         CDS       T00611                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_0078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_0078
   00052 Galactose metabolism
    Cmaq_0078
   00500 Starch and sucrose metabolism
    Cmaq_0078
   00520 Amino sugar and nucleotide sugar metabolism
    Cmaq_0078
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cmaq_0078
   00524 Butirosin and neomycin biosynthesis
    Cmaq_0078
Enzymes [BR:cma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cmaq_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(91627..92580)
Genome map
AA seq 317 aa AA seqDB search
MVDVTVVIDIGGSKIASALIYSDGKVEDYRVQSIDERGGEYAVNQVIETIRHYISGLSGV
NLIGVGISIPGIVRENGLVWAPNIRGWRNINVALMIKRKLNLSNLTIIDDRVANIMGEYW
QGAARGVSNAVSLMIGTGVAAGLLINGKPLRGSSGVAGAVGWWLLSRRIPRHKSSRGFLE
DQISGPALFRKTYRYCLRIRDESCLNIIRNCNTHNAHCIFQMLDQGVALIKPVLEEAATI
VGITAANLISLINPEVLVLSGGVGVEIGRRFMNTILKSVKVAQPHSLRRSRIVVSQLGYL
SNLYGLAHCIMSSNNCA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatgtaactgtggttattgatattggtggatctaagattgcatcagcgttaatt
tacagtgatggtaaagttgaggattatagggttcaaagcattgacgagaggggaggtgaa
tatgcagtgaatcaagttattgaaactatacgacactacattagtggtcttagtggagtt
aacttaattggtgtaggaatcagcatacctggaatagttagggagaatgggttagtttgg
gcacctaacataaggggttggaggaatattaatgttgccttaatgattaagaggaagctt
aatctaagtaacttaaccattattgatgatagggttgccaacattatgggtgagtattgg
cagggggcagccaggggggtgagcaatgcagtgtcattaatgattggtaccggtgtggct
gctggattattaattaacggtaaaccattaagggggagtagtggtgttgcaggggcagtg
ggttggtggttactgagtaggagaatacctaggcataaatcatcaagaggattccttgag
gatcagatatcaggcccagcattattcaggaaaacatacaggtactgcctacgtatacgc
gatgaatcctgcctcaacattattaggaactgtaacacacacaatgcccactgcattttc
caaatgcttgatcaaggggtagcattaattaaaccggtgctagaggaggcggcgacgata
gtgggtattactgcggctaacttaattagtctaataaatcctgaggtattagtattaagt
ggtggtgtgggggtggaaattgggagaagattcatgaatactattctgaagtctgttaag
gtagctcaaccacactcccttaggagaagcagaattgtagtttcacagttaggttactta
tctaacctctacggcttggcccactgcataatgagtagtaataattgtgcatga

DBGET integrated database retrieval system