KEGG   Caldivirga maquilingensis: Cmaq_0080Help
Entry
Cmaq_0080         CDS       T00611                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cma  Caldivirga maquilingensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cmaq_0080
Enzymes [BR:cma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cmaq_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
93529..95676
Genome map
AA seq 715 aa AA seqDB search
MSFPVSVWYGVGSVTPLFDEETIKRDLKNIKEAGFKYVRGWVNWRDSEPRPGEYDFSGVE
NLLKTANDIGLRVILQVYLEFAPDWLPKLHPDSLYVSESGSVIMPQGSPGVCLDHPGVRA
RAEEFMRKLAQVVIKYPNFYVWDLWSEPNVIQWIYQPTGWRGLFCYCNYSKGRFRDWLKT
IYGNVNTLNKAWHRSYLEFNDVEPPRFVSLHFARDNIDWLTFNIVKLKEDLEWRVKVIRS
IDNNHPVVSHSHGGTSVFSNPLFGEPDDWEMASVVDAWGTSFYPKHAGRVKVDHVLDSLV
LDAARSAALASGKPYWIGELQAGQGVGGLKAVEPVTPDDVALWMWQAIAHEAKAINIYHW
YPMMLGFESGGYGLINPDGSLTDRARKAGETARVIYENSDLFLKAKLIDSSVAILYNIES
YKWLWIAQRHSSDVLSRSILGVYRVLFNSNYNVDLVSIRQVEGNLISKYKVLIAPLSLVM
TLKAALGLRNFVSNGGLLLVDSRFAAIRSDGYIDSGTPAYGLSEVIGGYEDGYMSVDKVN
LRITSNLIPGLKTGDLIIGSNYVSWLNSKANEVGVSEFNLSKPSITINDYGKGKAIYVGT
SIGLSYEANGPGSGVGKLIEGIMNIAMVQPPVEVKSTREGYIEVRIMRSGADYLLFIINH
SYGDQLVNVRINENVINVGNASIKDLVTGASISITNNELQLTLRGRQVVVGLVSI
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttccggtttccgtatggtatggtgtaggtagcgttaccccactgtttgatgag
gaaaccattaagagggatttaaagaacattaaggaggctgggtttaagtatgttaggggt
tgggttaactggagggattctgaaccaagacccggggagtatgatttcagtggagtcgag
aatctgcttaagaccgctaacgacattggcttaagggttattcttcaggtttaccttgaa
ttcgcccccgattggttacctaagcttcacccagactcactatacgtctctgagtcaggc
agcgttatcatgcctcaaggtagccctggggtttgccttgaccaccctggtgttagggct
agggctgaggaattcatgaggaagctggctcaagtagtgattaagtaccctaacttctat
gtctgggacttatggagtgaacccaatgttattcagtggatttaccaacccactggttgg
cgtggattattctgctactgcaattactctaagggtaggttcagggattggttaaagact
atatacggcaacgttaacacgttgaataaggcctggcataggagttacctggagtttaat
gatgttgaaccaccgcgtttcgtctcccttcacttcgctagggataacattgattggtta
acattcaatatagttaagcttaaggaggaccttgaatggagggttaaggtaattaggagt
attgataataatcacccagtggttagtcatagtcatggcggtacctcagtgttcagtaat
ccactcttcggtgaacctgatgattgggaaatggccagtgtggttgatgcatggggtaca
tcattttaccccaagcacgcaggtagggttaaggttgaccatgttcttgactcactagta
cttgatgcagctaggtcagcggcattagccagtggtaaaccatactggataggggagctt
caagctggtcaaggtgttggtgggcttaaggcggttgaaccagtgacacctgatgatgtg
gctctttggatgtggcaggcgattgcacatgaggctaaggcaattaacatatatcactgg
taccctatgatgcttggttttgagtcaggtgggtatgggttaattaaccctgatggttca
ttaaccgatagggctaggaaggctggggaaacagccagggtgatttacgagaatagtgac
ctattcctaaaggctaagttaattgactcaagtgtggctatactttataatattgagtcg
tataagtggctttggattgctcaaaggcatagtagtgatgtattatcaaggtcaatactg
ggtgtttatagggttctcttcaatagtaattataatgtggatttagtatccattagacag
gttgaaggaaacttaattagtaagtacaaggtgcttatagccccattatcactggtaatg
acccttaaggctgccctaggtttaaggaactttgtaagtaatggtggattactactggtt
gattcaaggttcgcagcgattaggagtgacggttacattgactcaggtacaccggcgtat
gggttaagtgaggttattgggggttatgaggacggctacatgagtgtggataaggtgaac
ttaagaatcactagtaatctaatacctggtttaaagaccggtgacttaataattggttct
aattacgttagctggcttaattcaaaggctaatgaagtaggggttagtgaatttaactta
agtaaaccttcaataaccattaatgattatggtaaagggaaggcaatctacgtgggtaca
agcattggtttatcctatgaggctaatggaccagggagtggtgttggaaaattaatagaa
ggcatcatgaatattgccatggttcaaccacctgttgaagttaagtcaaccagggagggt
tacattgaggtaagaataatgaggagtggtgctgattatttactcttcataataaatcac
tcctacggtgatcaactagttaatgtgagaattaatgagaatgtaattaatgtgggcaat
gcatcaattaaggaccttgtaactggtgcatcaataagtattactaataatgagcttcag
ttaaccctaaggggtaggcaagttgtagtagggcttgtgtctatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system