KEGG   Caldivirga maquilingensis: Cmaq_0184Help
Entry
Cmaq_0184         CDS       T00611                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cma  Caldivirga maquilingensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
219387..220298
Genome map
AA seq 303 aa AA seqDB search
MRLKLNAPEVMAVINVSPESFYSASVKSTEEELLKFAINVFKAGVRIFDIGGMSTAPFKR
TWVPEDVELSRLKWAVNLLRGELGDRIIISVDTFRPRVASEVAKLGVDVLNDVTGLRYDK
GLAKVAKEHGLAMILCAREATQSGLNPVEAIINEAKWSINVAESMGVNDIIIDPCIGFPP
LDRDQNLEPNRQVPNTRYDDWPYRDIYLVANAARIRRELGKPICVGVSRKGFIRRLLGGG
VEDSIWGTLGLHAYLAYVGVDVIRAHDAVETLNVVKIINMVKECGGDYLSCIDNVRKAYK
EAD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagacttaaattaaatgcacctgaggttatggcagtcattaacgtaagccccgaatcc
ttttactcagcaagtgttaaatcaactgaagaggagttgcttaaattcgccattaatgtg
tttaaggctggtgtaaggatctttgacattgggggaatgtccactgcgccatttaagaga
acttgggttcctgaggatgttgagttaagtaggcttaaatgggcagtaaacctactgagg
ggggagttgggtgataggattatcatatctgtggacaccttcaggccacgtgtagcctct
gaggtggctaaattaggtgtagatgttttgaatgatgtgactggtttaaggtatgataag
gggttggctaaggtggctaaggagcatggattagccatgatactgtgcgcaagggaggct
actcaaagtggcttaaatcccgttgaagctattattaatgaggctaagtggagtattaat
gttgctgaatccatgggtgttaatgatattataatcgacccatgcataggcttcccacca
cttgatagggaccagaacctggagccgaataggcaggtacctaatacgcgttacgatgac
tggccctatagggatatttaccttgttgctaacgccgcaaggataaggagggaacttggt
aaacctatttgcgttggcgtatcaaggaagggattcataaggaggctactgggtggtggt
gttgaggattccatatggggaacactggggcttcacgcatacttggcctacgtgggtgtg
gatgtaattagggctcatgatgcagtggagactcttaatgttgttaaaattattaatatg
gtgaaggaatgtggtggtgattatttaagctgcattgataacgtgagaaaagcttataaa
gaggctgattaa

DBGET integrated database retrieval system