KEGG   Caldivirga maquilingensis: Cmaq_0206Help
Entry
Cmaq_0206         CDS       T00611                                 

Definition
(GenBank) Cellulase
Organism
cma  Caldivirga maquilingensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABW01055
JGI: Cmaq0206
UniProt: A8MAL9
Position
243755..244807
Genome map
AA seq 350 aa AA seqDB search
MDAATLSKLTLEIGPSGFEDRVIRTIISMIRNRVDEVNVDNMGNLIARIGNGPFKLMISA
HADEVGVMVSHIDQRGFIKVVPIGGIDPWVMIEQELVFMGRNGDIYGTVGVDPPHLRRDK
PPSRFEELYVDAGFTSNDEAFKAGILPGVAGTFAASFRERGSVVIGKALDNRVGCSVLVD
LAEEAGGMVTGDLSLYLVWNTQEEVGLRGINAAVNAINPNMAIVVETTVAADVPTNPENE
WITRIGNGAAIRALDRSMITNPRLLSAVLELASSRGIKYQVQVNPYGGTDAGAIHVHGTG
VPTVVVSTPARYIHTPHSVVNLSDVEQVKSMITLIVREHAELSRVMRIQA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgcaacattatctaaactaacccttgagattggcccatcaggtttcgaagat
agggtgataagaacaataataagcatgattagaaatcgtgttgatgaagttaatgtagat
aacatgggtaacctaatagcgaggattggtaatggtccttttaaactaatgataagtgcc
catgctgatgaagtaggtgttatggtttcacacattgatcaaagaggcttcattaaggtt
gttccaataggtgggattgatccatgggttatgattgagcaggagttagttttcatggga
cgtaacggtgacatatatggcactgttggtgttgatccaccgcacttaaggagggataag
cctccatccaggtttgaggagctttacgttgatgccggcttcacctctaatgatgaagcc
tttaaggcaggtatattacctggtgtggcagggacctttgcggcgtcatttagggagagg
ggcagtgtagtaataggtaaggcgttagataatagagtcggctgcagtgtacttgtggat
ttagctgaggaggctgggggaatggttaccggtgacttatccctttacctggtttggaat
acgcaggaggaggttgggttaaggggtataaatgcggctgttaacgccattaacccaaac
atggccattgtcgttgaaacaaccgttgccgcagatgttccaactaatcccgagaatgaa
tggataactaggataggtaatggtgctgcaattagggctttagatagatccatgataact
aacccacggttactatcagccgtattggagttagcatcatcaaggggaattaagtaccag
gttcaagtcaacccatatggtggcactgacgccggtgctatacatgtccacggtacaggt
gtaccaacagtagttgtatctacaccagccaggtatatccacacaccccactcagtggtt
aatctcagtgatgttgagcaggttaagtcaatgatcaccctaatagtgagggaacatgct
gaattaagtagggtaatgaggattcaggcttaa

DBGET integrated database retrieval system