KEGG   Caldivirga maquilingensis: Cmaq_0256Help
Entry
Cmaq_0256         CDS       T00611                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_0256
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_0256
   00620 Pyruvate metabolism
    Cmaq_0256
   00640 Propanoate metabolism
    Cmaq_0256
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cmaq_0256
   00680 Methane metabolism
    Cmaq_0256
Enzymes [BR:cma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cmaq_0256
Lipid biosynthesis proteins [BR:cma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cmaq_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
291878..293878
Genome map
AA seq 666 aa AA seqDB search
MSISEENLPYKEKIELKSWPNSTDIDSYRKMHGKSLENIEEHWANVAKELDWFKPWDKVL
VADPQPPFYKWFVGGKLNASYLAVDRHANTWRRNKLAIIWEGEPTDSSGNPLEVRKLTYY
DLYREVNRLAYAIRSKLGLRKGDTVTIYLPMIPELPILMLALARLGVIFSVVFSGFSAQA
LADRVMDAKSKVIFTADAFWRRGKVVRLKEVVDEALKGIQFVEKVVVFRRMGLKDTPMVN
GRDIWWDELLSDVPMNTYVKPEEIESEHPLYILYTSGTTGKPKGIVHDTGGYMTLLHATM
KWVFDIKDTDVYWCTADIGWVTGHSYIVFGPLMEGVTEVMYEGAPDYPTPDRWWRIVERY
GVTILYTSPTAIRTFMRYGDDWVKGHDFSTIRILHSVGEPINPEAWKWAWKWLGRGSVPF
GSTWWMTETGGILISHAPGLALIPLKPGTNGLPLPGIDADVVDDEGKPVQGKRGYLVIKK
PWPGMLMTIWGDPNRYIQVYWSRFPGMYYAGDWAIKDEDGYIWVLGRADEVIKVSGHRLG
TYEIESALVSHKAVAESAVVGVPDPVRGEVPVAFVVLKSGVNPSQELVKELRNWVRTAIG
PIAEPANIVFVSKLPKTRSGKIMRRLLKQVLMKQPLGDTTTLEDETSIDEAKKAYEELAR
ELNQQG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattagtgaagagaatctgccttataaggagaagattgaattaaagtcctggcca
aactccacggatatagattcctacaggaaaatgcacggtaaaagccttgagaatattgag
gaacactgggctaacgttgctaaggaattggattggtttaagccctgggataaggttctt
gtggctgatcctcaaccaccattctacaagtggtttgttggaggtaagttaaacgcatca
tacctagccgttgataggcatgccaacacttggcgtaggaataagttagcgataatatgg
gagggggagccaactgactcatcaggtaacccactggaggttaggaagttaacttactat
gatttatacagggaggttaatagattggcttacgcaattaggagtaagctcggcttaagg
aagggggatacggtgacgatatacttacccatgatacctgaattaccaatactaatgctt
gcattagccagattaggggttattttctcagtggtcttctcagggttcagcgcccaggca
ttggcggatagggtaatggatgctaaatctaaggtaatattcaccgccgacgccttctgg
aggagggggaaggtggttaggcttaaggaggttgttgatgaggcattaaagggtattcaa
ttcgttgagaaggtagtggtgtttaggagaatgggtcttaaggatacaccaatggttaat
ggtagggatatttggtgggatgaattactaagcgatgtacccatgaatacctacgttaag
cccgaggagattgagagcgagcacccactctacatcctatacacctccggcaccactggt
aagcctaagggtattgtgcatgatactggaggctacatgacactcctccatgccacaatg
aagtgggtcttcgacattaaggacactgacgtatactggtgcactgccgacattggttgg
gtaactgggcatagttacattgtctttggaccattaatggagggtgtaaccgaggtaatg
tatgagggcgccccagactacccaaccccagataggtggtggaggattgtggagaggtat
ggtgtaaccatactgtacacctcacccacggcgataaggacattcatgaggtatggtgat
gattgggttaagggccatgacttctcaacaataagaatacttcacagtgtgggtgaacca
ataaaccctgaagcctggaagtgggcttggaagtggcttgggaggggtagtgtacccttt
ggttcaacatggtggatgactgaaacagggggcatactaataagccacgcacctggatta
gccttaatacctcttaagcctgggactaatggattaccgttacctggcattgacgccgat
gtggttgatgatgaggggaagcctgttcagggtaagaggggttacttggttattaagaag
ccgtggcctggaatgttgatgactatttggggtgatcctaataggtatattcaggtgtat
tggagtaggttcccaggcatgtactatgccggtgactgggctattaaggatgaggatggt
tacatatgggttttaggtagggccgatgaagtcattaaggtatccggccataggcttggt
acatatgaaatagagtcagccctagtttcccataaggccgtagccgagtcagcggtggtc
ggtgtccctgaccctgttagaggcgaagtcccagtggccttcgttgtacttaagagtggg
gttaacccaagccaggaattggttaaggagttgaggaattgggttaggactgcaataggc
ccaatagctgaaccagcaaacatagtcttcgtctcaaagctacctaagactaggagtggg
aagataatgaggaggctgcttaagcaagtactcatgaagcagcccctcggtgatacaacc
accctggaggatgagacgagtattgatgaggctaagaaggcttatgaggaattagccagg
gagcttaaccaacaggggtaa

DBGET integrated database retrieval system