KEGG   Caldivirga maquilingensis: Cmaq_0270Help
Entry
Cmaq_0270         CDS       T00611                                 

Definition
4Fe-4S ferredoxin
Orthology
K11473  
glycolate oxidase iron-sulfur subunit
Organism
cma  Caldivirga maquilingensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cmaq_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308339..308647
Genome map
AA seq 102 aa AA seqDB search
MLINDEAKLIVNEYALTRCARCNFCESVCPTYIAFRRRVYGPRGRIWIIMFLSQGVKLSN
DESTGLLTCLGCRACDLVCPAGIRIAEAIHDAKVLLVKAALK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaatgatgaagctaagttaattgttaatgaatatgccttaaccagatgcgcc
cgctgcaacttctgcgagtccgtttgcccaacatacattgcatttaggcgtagggtttat
ggaccaaggggtaggatatggataataatgttcctttctcaaggcgttaagctaagtaat
gatgagtccacaggcctattaacatgcctagggtgtagggcatgtgacctagtatgccca
gcaggcattaggatagctgaggctattcatgacgccaaggttctactggttaaggctgct
ttaaagtag

DBGET integrated database retrieval system