KEGG   Caldivirga maquilingensis: Cmaq_0408Help
Entry
Cmaq_0408         CDS       T00611                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cma  Caldivirga maquilingensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cmaq_0408
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cmaq_0408
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cmaq_0408
Enzymes [BR:cma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cmaq_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(443642..445111)
Genome map
AA seq 489 aa AA seqDB search
MDISFPKSFRFGWSQAGFQSEMGTPGSEDPNTDWYVWVHDPENIASGLVSGDLPEHGPGY
WGLYRMFHDNAVKMGLDIARINVEWSRIFPKPMPDPPQGNVEVKGNDVLAVHVDENDLKR
LDEAANQEAVRHYREIFSDLKARGIHFILNFYHWPLPLWVHDPIRVRKGDLSGPTGWLDV
KTVINFARFAAYTAWKFDDLADEYSTMNEPNVVHSNGYMWVKSGFPPSYLNFELSRRVMV
NLIQAHARAYDAVKAISKKPIGIIYANSSFTPLTDKDAKAVELAEYDSRWIFFDAIIKGE
LMGVTRDDLKGRLDWIGVNYYSRTVVKLIGEKSYVSIPGYGYGCERNSISPDGRPCSDFG
WEFYPEGLYDVIMKYWSRYHLPIYVTENGIADAADYQRPYYLVSHIYQVYRAIQEGANVK
GYLHWSLTDNYEWASGFSMRFGLLQVDYSTKKQYWRPSAYVYREIAKSKAIPEELMHLNT
IPPTRSLRR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatatctcatttccaaaatccttcaggttcggctggtcccaggcggggttccagtct
gaaatgggtactccaggtagtgaggaccctaacaccgactggtacgtgtgggttcatgat
cctgagaacattgcttcgggcttagttagcggtgatttacctgaacatgggccaggttac
tgggggctttacaggatgtttcatgataatgcggttaaaatggggcttgatatcgctagg
attaatgttgagtggtctcgaatattccctaagccaatgcctgacccaccgcagggtaac
gtggaggttaagggtaatgacgtgttggccgtgcatgttgatgagaatgatctcaagagg
cttgatgaagccgctaaccaggaggctgtgaggcattatagggagattttcagtgacctt
aaggctaggggaatacacttcatactgaacttctaccattggccactgcccctttgggtc
catgacccaatcagggttaggaaaggtgacttaagtggacccactggttggcttgatgtt
aagaccgtcattaacttcgctaggtttgcagcctacactgcctggaagttcgatgacctt
gccgatgagtattcaacaatgaatgaacccaatgtagttcacagtaatggctacatgtgg
gttaagtcaggtttcccaccaagttaccttaactttgaattatcaaggagagtcatggtt
aatttaatacaggcccatgctagggcttatgacgctgttaaggctatttccaagaagccc
attggcataatatacgctaactcatccttcacaccgctaactgataaggatgctaaggcc
gttgagttggctgagtatgattcaaggtggatattcttcgatgcaataattaagggtgaa
ttaatgggggttactagggatgacttgaagggtaggcttgactggattggggtaaactac
tactctagaacagtggttaagcttattggtgagaaatcctacgtgagcatacctgggtat
gggtatggttgcgagaggaattcaattagccctgatggtagaccatgcagtgacttcggt
tgggaattctacccggagggtctttatgatgtaataatgaagtactggagccgctatcac
ttacccatatacgttactgagaatggtattgctgatgcggctgattaccagaggccatat
tacttagttagccacatttaccaagtctatagggctattcaagagggggctaacgttaag
ggttacctacactggtccctgactgataattacgagtgggcctcaggcttcagcatgagg
tttggtttacttcaagtagactactccactaagaagcagtactggaggccatcagcctat
gtttacagggagattgctaaatctaaggctataccagaggagttaatgcaccttaacact
ataccacccactaggtcattaaggaggtga

DBGET integrated database retrieval system