KEGG   Caldivirga maquilingensis: Cmaq_0703Help
Entry
Cmaq_0703         CDS       T00611                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_0703
   01230 Biosynthesis of amino acids
    Cmaq_0703
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_0703
   00051 Fructose and mannose metabolism
    Cmaq_0703
   00562 Inositol phosphate metabolism
    Cmaq_0703
Enzymes [BR:cma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cmaq_0703
Exosome [BR:cma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cmaq_0703
  Exosomal proteins of bladder cancer cells
   Cmaq_0703
  Exosomal proteins of melanoma cells
   Cmaq_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(738920..739597)
Genome map
AA seq 225 aa AA seqDB search
MKVPVLIINMKAYPELLGGGAVKLAQVAEKVANNLGASIIVAPPHTYLRQVAESVNIPVY
AQSADPVDPGARTGHIPLEFIKDAGASGVIINHSEHRLLLNDIAMLVNKAKALNLETVVC
SPDPLSSAAAAALAPTAVAMEPPELIGTGKSVSRTKPDVVVETVNAVKRVNGDVKVITGA
GIEDYNDVAKAIELGTVGVLVASAIVKAKDWEAKITELAKPLVGK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttccagtactcataataaacatgaaggcttacccagagttactggggggtggt
gccgttaagctggctcaagtagctgagaaggttgctaataacctgggtgcatccataata
gttgcaccaccgcacacttacctaaggcaggttgctgaatccgtaaacatacccgtttac
gcgcagtcagctgacccagtggatccaggggctaggactggccacatacccttagagttc
attaaggacgctggggcttcaggtgtgattataaatcatagtgagcataggttactgtta
aatgacatagccatgcttgttaataaggccaaggcccttaaccttgagacagtggtgtgt
tccccagacccattatcaagtgccgctgcggctgcccttgcacccacggcagttgccatg
gagcctcctgaattaataggcacaggtaagtccgttagtaggactaagcctgatgtggtt
gttgaaacggttaatgcagttaagagggttaacggtgatgttaaggttattacaggtgcc
ggtatagaggattataatgatgttgctaaggcaattgaattaggtacagtgggtgtattg
gtggctagtgcaatagttaaggctaaggattgggaggctaagataactgaattagctaaa
ccccttgtgggtaagtga

DBGET integrated database retrieval system