KEGG   Caldivirga maquilingensis: Cmaq_0830Help
Entry
Cmaq_0830         CDS       T00611                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cma  Caldivirga maquilingensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cmaq_0830
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cmaq_0830
   00600 Sphingolipid metabolism
    Cmaq_0830
Enzymes [BR:cma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cmaq_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(871868..873262)
Genome map
AA seq 464 aa AA seqDB search
MASRHGFKIALIGAGSAAWAIGLIKDLALIPSLSGSTVVLMDIDEDRLALVSRFAKRYVS
EVKGNLNIVTTTDRREAIRDADFVVNSTLAKGHGHYERMREVSEKYGYYRGINSVEWNMV
SDYHTIWGYYQFKLALDIANDVVDYAPNAWLLNVSNPVFELTTLISRETKARVIGLCDGY
YAYRDLLRVLGLEEGKAEVEVIGVNHDDWLTRLKYNGEDAYHLIDEWISTKSSQYFEKWR
EEQSNPFDVHVSPVAVDMYRMYGLWPIGDTVRSGTWKYHWDLKTKQYWYGPLGGPDSEIG
WAMYLTWHKIEFNELKRALENEAKPLTDYIPPVRSEGEPVTMVIEAIVEDSGKVIEVNVP
NQDAIPGIPSDVAVEMPARVDAKGVHRLSFSNLPKAWGKVLKYAIMPRVIRGEWAIEAFL
GGGRDTLFNWLIIDPRTKSSDQVNQVIDAILKIPGNEEMAKHFS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaggcatggttttaagatagccctaataggggctggtagtgcggcgtgggct
attggtcttattaaggacctagccctaataccaagcttaagcggtagtaccgtggtttta
atggatattgatgaggataggttagctttagttagtaggtttgccaagaggtatgtttct
gaggttaagggtaatttaaacatagttaccaccactgataggagggaggctattagggat
gctgacttcgtggttaactcaaccctggctaaggggcatgggcactatgaaaggatgagg
gaggtttctgagaagtacgggtactataggggtattaatagtgttgagtggaacatggtg
tctgattaccacacaatatggggctactaccagtttaaactagccctagatatagctaat
gatgtggtggattacgcacctaatgcatggttacttaacgtatctaacccggtcttcgag
ttaacaacattgattagtagggagactaaggctagggttattgggttgtgtgacggctac
tacgcctatagggatttactcagggttcttggtctcgaggagggtaaggctgaggttgag
gttattggtgttaatcatgatgactggttaactaggcttaagtacaatggcgaagacgca
taccaccttattgatgagtggatcagcactaagtccagtcaatacttcgagaagtggagg
gaggagcagagtaacccctttgatgttcatgtttcaccagtggcggttgacatgtatagg
atgtatggcctatggccaataggggacaccgttaggagtggtacatggaagtaccactgg
gatcttaagaccaagcaatactggtatgggccactcggtggacctgactcagagattggg
tgggccatgtacttaacgtggcataagatcgagttcaatgagcttaagagggcgcttgag
aatgaggctaagccattaacagactacataccgccagttagaagtgagggtgagccggtt
acaatggttattgaggctattgttgaggatagtggtaaggtaattgaggttaatgtacct
aatcaggatgcaatacctggaatacccagtgatgtggctgttgaaatgccggctagggtg
gatgctaagggtgttcatagattaagcttcagtaacctacctaaggcgtggggtaaggtg
cttaagtacgctataatgcctagggtaattaggggtgagtgggcgattgaggcattccta
gggggtggtagagacacgttatttaactggcttataattgatccaaggactaagtccagt
gatcaagtcaaccaggttatagatgcaatacttaaaatacctggaaatgaggaaatggct
aaacacttcagttaa

DBGET integrated database retrieval system