KEGG   Caldivirga maquilingensis: Cmaq_0900Help
Entry
Cmaq_0900         CDS       T00611                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cma  Caldivirga maquilingensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cmaq_0900
Enzymes [BR:cma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cmaq_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(941026..943704)
Genome map
AA seq 892 aa AA seqDB search
MLLCGEMHYFRVPRGLWEDRLLKIKRAGLNCLNTYFAWNYHEVEPGVFDFSGEKDVDVYL
SKAEELGLKIIARVGPYICSEWDNGGHPDWLLSRGLVPRSLDSSYWPYAERWLRVILPIV
VKHQEPNGGVDIVQLENEYFWGDAPLHMKLAELARQVGVTAKLYTNVNRYVRNTVYTDAL
DLYPSPWDLNSVIWSIKDLLETQGGRPKILEYEGGWFSVIHRPLPTSRGSFPPDWTRILL
ATALAYGSDVVSFYMFHGGTNFGYWTGRWITTTYDYEASIREWGELSERYYKVKLITPLA
EFIDGSETEGESYDNGKLLVIRRKGDLRLKFYINNTETDWIDGDVKVPARGVKVIPSNLS
VKGATISETNLSLLTVRDGDVLLYGNAGEEFKIRLKGGLVKSCLGVEYRTEGDSIVLSGK
VPGELNGCLIEGKGNVRVLILSELFASRTWIMNDYYVPSNVYLIRDGNYNSLLIEAKEGV
NVLYLPFKSSKGRYIPELDLTRIELNVNVEQPNVSITQVTKGSVSIKPILKISDIKPLEE
LGLFKHGLYIYDTKLNASGLIGFIAHDYAAVINNGRVTANGFIYIKTNANAGDLRIVVES
TGHPNDGTIPFFTGLQSPVLINQVGSIKVDSWEYGILDLSSRLKPGIATNYSHTMVINKE
IKEYLPKVKWVKSISDLGKPNNAVIYYRGRIHLNEARHVILRISKADQWAAMVIFINGEE
VYRGHGDEPFETTVYGGLRSGDVEVVIALLRYGIKEINSTPGNVEIDLWGGIINDYSLSI
MELGEARDSVKLPLIISEPSTIKLKFTVNKPSDTNAPLNVELSGRIHALIYLNGILIGRY
YPGDSQSMFYLPEPYLSEENELTILATPVESNATVNVTFKPYMVTRIINLTL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgctcctatgtggtgaaatgcattacttcagggtccctaggggtctttgggaagatagg
ctgcttaagattaagagggctgggttaaactgcttaaacacctacttcgcttggaattac
catgaggttgaaccaggggtatttgacttctccggggagaaggacgttgacgtgtactta
agtaaggctgaggagcttggccttaagataattgccagggttggaccctatatatgttcg
gaatgggataatggtggacaccctgactggttactgagtaggggattggtgcctaggagc
cttgactcatcctactggccttacgctgagaggtggcttagggtaatattacccattgtt
gttaagcatcaggaacctaatggtggtgttgatattgttcaattggagaacgagtacttc
tggggtgatgcaccactccacatgaagctagctgagttagctaggcaggttggtgttact
gctaagctgtacactaatgttaataggtatgttaggaacacagtgtacactgatgccttg
gatctttacccaagcccatgggacctaaactcagtaatatggagtattaaggatctcctg
gaaacccagggtggtaggcctaagatacttgagtatgagggtgggtggttctcggttatt
cataggccattaccaacatcaaggggtagtttcccacctgactggactaggatactttta
gcaacggcattagcctatggttcagatgttgtaagcttctacatgttccatgggggcact
aatttcggttactggactggtagatggataaccactacttatgattatgaggcttcaatt
agggagtggggtgaattaagtgaaaggtactataaggttaagttaattacaccactggct
gaattcattgatggtagtgaaacagagggtgaatcatacgataacggtaagctattagtt
attaggcgtaagggtgacttaaggttaaagttctacattaacaacactgagactgattgg
attgatggtgatgttaaggttccagcaaggggtgttaaggttattccaagtaacttaagc
gttaagggtgctacaattagtgaaacaaacctaagcctactgaccgttagggatggtgat
gtgttactttacggtaatgccggtgaggaattcaaaattaggcttaagggtggcttagtt
aaatcatgcctaggtgttgagtatcgtactgaaggcgactcaatagtgctgagcggtaag
gtgccgggtgaattaaatggttgcttaattgagggtaaaggtaatgttagagtgttgatt
ctaagtgaattattcgcatccagaacctggataatgaatgattactatgttccatcaaat
gtatacttaattagggatggtaactacaactcactgttaattgaggctaaggagggtgtt
aacgtgctttacctaccctttaagtcaagtaagggtaggtacattcctgaactggactta
accaggattgaacttaacgttaatgttgagcaacctaacgtatccataacccaggtgact
aaaggctcagtgagtattaaacctattcttaaaattagtgatattaagccccttgaggaa
ttaggcttgtttaagcatggattatacatctacgacaccaagcttaacgcaagtggatta
ataggcttcatagcccacgattacgccgcagtaattaataatggtagggttacggcaaac
ggcttcatatacattaaaaccaatgctaacgccggtgacttgaggatagtggttgagtca
acaggtcaccctaatgatggcaccataccgttcttcaccggtttacagtcaccagtctta
attaatcaagtcggtagtattaaggttgattcatgggaatacggtatacttgacttatcc
agtagacttaagcccggtatagcaaccaattacagtcacaccatggtgattaataaggag
attaaggagtacttacctaaggttaagtgggttaagagcattagtgacttaggtaaacca
aataatgcggttatttactataggggtagaattcatttaaatgaggcgaggcatgtaatt
cttaggatcagtaaagccgatcagtgggccgcaatggtgattttcattaatggggaagag
gtctataggggtcatggcgatgaaccattcgaaaccacggtatacggtggtttaagaagc
ggtgacgttgaagtagttattgcattactaagatacggcattaaggagattaattcaacc
ccagggaatgttgagattgatttatggggcggcatcattaatgactacagcttaagcatt
atggagttaggtgaggcaagggatagcgttaaattaccgttaatcataagtgagccatca
accattaagcttaagttcacggtcaataaaccaagtgatactaatgcaccacttaacgtt
gagttgagtgggaggatccacgcattaatatacttgaacggtatattaatcggcaggtat
tatccaggcgattcacaaagcatgttctacttacctgaaccatacttaagtgaggagaat
gaattaaccatattagccacaccggttgaaagcaatgccacagtgaatgtaacgtttaag
ccctacatggtgacgaggattattaacctaactctatga

DBGET integrated database retrieval system