KEGG   Caldivirga maquilingensis: Cmaq_0950Help
Entry
Cmaq_0950         CDS       T00611                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cma  Caldivirga maquilingensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cmaq_0950
Enzymes [BR:cma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cmaq_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
998225..999379
Genome map
AA seq 384 aa AA seqDB search
MNNYKAKLSVVIMSNEEFINLLKELSEAFGPSGFEDEVRELVIKEMEPYVDELEVDKWGN
VIGVRYGSRRDLKVMIAAHMDEIGLLIDSIDKNGFLRFRGIGGWNEVTLVGQRVIIKTQD
GGKIKGVVGSRPPHVTPPGKEREAPEMKELFIDIGASDSSEVEKLGVRVGSVAVLDRSFE
VLNNDTVTGKAFDDRVGLAVMLWMLRQLKNHEVTVYTVATVQEEVGLKGAQVAADRVYPD
FAIALDTTIAADVPGVSEREYVSRLGAGPALKIMDGGRGGLFIAHPGLTNYIINIAKANN
VPYQLEVLIGGTTDAAGIALRRDGIPAATISIPTRYVHSPVEVLKVSDAVNASRLLTLVV
QGANEGLISSLRSRVIKGVGFKVT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattataaagctaagttaagtgtagtcattatgagtaatgaggaattcataaac
ctactcaaggaactctccgaggcgttcggtccctctggctttgaggatgaggttagggaa
ttagtgattaaggaaatggaaccttacgtggatgaattggaggtggataaatggggtaat
gttattggtgttaggtacggtagtaggagggatcttaaggtaatgattgcagcccatatg
gatgagataggtttacttattgatagtattgataagaatggtttcctaaggtttaggggt
attgggggatggaatgaggtaactttagttggtcaaagagtaatcattaagactcaggat
ggtggaaaaataaaaggtgtagtgggtagtaggcctccgcatgtgacgcctccaggaaag
gagagggaggctccggagatgaaggaattattcattgatattggggcaagtgattcaagt
gaggttgagaaacttggggtgagggttggttcagtggcggtattggataggtcctttgag
gtccttaataatgatactgtaaccggtaaggcatttgatgacagggttgggttagctgta
atgctgtggatgcttaggcaattaaagaaccatgaggtaacagtgtacactgtagccact
gttcaagaggaggttgggttaaagggtgcgcaggttgccgctgacagggtttacccagac
ttcgcaatagccttagatacaaccatagctgctgacgtacctggtgtatctgagcgtgaa
tacgtgtctaggcttggtgcaggtccagcattaaaaataatggatggtggaaggggcggc
ttattcatagcccacccaggcttaactaactacattattaatatagctaaggctaataat
gtgccgtatcaattagaggtattgattggaggcaccactgatgctgctggtatagcctta
aggagggatggaatacctgcagcaacaatctcaatacccaccaggtacgttcactcacct
gtggaggtgcttaaggtaagtgatgcagttaatgcatcaagactactcacgctagtggtt
caaggggctaatgaagggttaataagcagtcttaggagtagggtgattaagggtgttggg
tttaaggtgacttga

DBGET integrated database retrieval system