KEGG   Caldivirga maquilingensis: Cmaq_0950Help
Entry
Cmaq_0950         CDS       T00611                                 

Definition
(GenBank) Cellulase
Organism
cma  Caldivirga maquilingensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
998225..999379
Genome map
AA seq 384 aa AA seqDB search
MNNYKAKLSVVIMSNEEFINLLKELSEAFGPSGFEDEVRELVIKEMEPYVDELEVDKWGN
VIGVRYGSRRDLKVMIAAHMDEIGLLIDSIDKNGFLRFRGIGGWNEVTLVGQRVIIKTQD
GGKIKGVVGSRPPHVTPPGKEREAPEMKELFIDIGASDSSEVEKLGVRVGSVAVLDRSFE
VLNNDTVTGKAFDDRVGLAVMLWMLRQLKNHEVTVYTVATVQEEVGLKGAQVAADRVYPD
FAIALDTTIAADVPGVSEREYVSRLGAGPALKIMDGGRGGLFIAHPGLTNYIINIAKANN
VPYQLEVLIGGTTDAAGIALRRDGIPAATISIPTRYVHSPVEVLKVSDAVNASRLLTLVV
QGANEGLISSLRSRVIKGVGFKVT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattataaagctaagttaagtgtagtcattatgagtaatgaggaattcataaac
ctactcaaggaactctccgaggcgttcggtccctctggctttgaggatgaggttagggaa
ttagtgattaaggaaatggaaccttacgtggatgaattggaggtggataaatggggtaat
gttattggtgttaggtacggtagtaggagggatcttaaggtaatgattgcagcccatatg
gatgagataggtttacttattgatagtattgataagaatggtttcctaaggtttaggggt
attgggggatggaatgaggtaactttagttggtcaaagagtaatcattaagactcaggat
ggtggaaaaataaaaggtgtagtgggtagtaggcctccgcatgtgacgcctccaggaaag
gagagggaggctccggagatgaaggaattattcattgatattggggcaagtgattcaagt
gaggttgagaaacttggggtgagggttggttcagtggcggtattggataggtcctttgag
gtccttaataatgatactgtaaccggtaaggcatttgatgacagggttgggttagctgta
atgctgtggatgcttaggcaattaaagaaccatgaggtaacagtgtacactgtagccact
gttcaagaggaggttgggttaaagggtgcgcaggttgccgctgacagggtttacccagac
ttcgcaatagccttagatacaaccatagctgctgacgtacctggtgtatctgagcgtgaa
tacgtgtctaggcttggtgcaggtccagcattaaaaataatggatggtggaaggggcggc
ttattcatagcccacccaggcttaactaactacattattaatatagctaaggctaataat
gtgccgtatcaattagaggtattgattggaggcaccactgatgctgctggtatagcctta
aggagggatggaatacctgcagcaacaatctcaatacccaccaggtacgttcactcacct
gtggaggtgcttaaggtaagtgatgcagttaatgcatcaagactactcacgctagtggtt
caaggggctaatgaagggttaataagcagtcttaggagtagggtgattaagggtgttggg
tttaaggtgacttga

DBGET integrated database retrieval system