KEGG   Caldivirga maquilingensis: Cmaq_1046Help
Entry
Cmaq_1046         CDS       T00611                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cmaq_1046
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cmaq_1046
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cmaq_1046
Enzymes [BR:cma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cmaq_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1096453..1097703)
Genome map
AA seq 416 aa AA seqDB search
MSGVPTHWYNIAVDLPKPLPPPMDPYEGESRIALLNRIMPSELLHQEFTSLMYVPIPDEV
REIYMRLGRPTPLRRARGLEKLIGNGVKIYYKFEGALPGGSHKLNTAVPQVYYASKDGAK
EVATETGAGQWGLAVSIAAALIGIKAVVFMTKSSYLSKRQRVMFMRTYGAMVYPSPSEVT
KYGVEAVKANPNHPGSLGLAISEAIDYVLQGEGRRYIPGSVLEFVLMHQTVIGQEAINQI
PEEPDLVVGCVGGGSNFAGLTYPFIGAKLRGEGFEKTRFLAVESKAAPKLTQGRYEYDFP
DSGGLLPMIRMLTLGHNYVPPPSHAAGLRYHGAAPSLSLLVKEGVVETRAYTQEEALEAG
VLFARSEGIIPAPESSHAIRAVIDEARRMPKGSVILFNLSGHGLLDPDAYEKVNAS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggtgttccaactcattggtataacatagccgttgacctacctaaaccactacca
ccacccatggatccctatgagggtgagtccaggatagctttacttaataggataatgccg
agtgaattacttcaccaggaattcacctcattaatgtacgtacccattcccgatgaggtt
agggaaatatacatgaggcttggtagaccaacaccactgaggagggctaggggtttggag
aagcttataggtaatggggttaagatctactataaattcgagggtgcgttaccgggtggt
tcacataaactcaacacagcagtgcctcaggtgtattatgcgtctaaggatggggctaag
gaggttgccactgagactggggctgggcaatggggcttagcagtatccattgcggctgcg
ttaattgggattaaggccgtggtcttcatgaccaagagctcctacttgagtaagaggcag
agggttatgttcatgaggacttacggggccatggtttacccaagccccagtgaggttact
aagtacggagttgaggccgttaaggctaaccccaatcacccaggtagcttaggcttagcc
ataagtgaggcaatagactacgtgcttcagggtgaggggaggaggtatattccaggtagt
gtgcttgaattcgtcctaatgcatcaaacagttatcgggcaggaggccattaatcaaata
cccgaggaacctgacctagtggttggatgcgttggcggtggaagcaacttcgctggttta
acgtacccattcataggggctaaactaaggggtgagggttttgagaagactaggttcctt
gcagttgaatccaaggcagcacccaagttgactcaaggcaggtatgaatacgacttccct
gattcagggggtttactacccatgattagaatgctaaccctcggtcacaattacgtacca
ccgccaagccatgcagccggcttaaggtaccatggggctgccccaagcctatcactactc
gttaaggagggtgttgttgagacaagagcctacacgcaggaggaggctcttgaggcgggt
gtattatttgcaaggagtgaaggcattatacctgcccctgagtcgtctcatgcaataagg
gctgttattgatgaagccaggagaatgcctaagggcagtgtaatattgtttaacctatct
gggcatggtttactggatcctgacgcctacgagaaggtgaacgcatcatga

DBGET integrated database retrieval system