KEGG   Caldivirga maquilingensis: Cmaq_1074Help
Entry
Cmaq_1074         CDS       T00611                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cmaq_1074
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cmaq_1074
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cmaq_1074
Enzymes [BR:cma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cmaq_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1125054..1126127)
Genome map
AA seq 357 aa AA seqDB search
MVLNLTNMSGEVTYKCPKCGFTTEANTWLIKCPRCGSPLNVNYDLRRPRELSRSELTRIL
PVKEPLSLGEGLTPLVRRGDYYFKLEYLNPTGSFKDRGWSLALSVLRNDVTVVEDSSGNA
GLSLAAYSAVKGVRARIYVPKTAPEAKKRLMRLLGANVVEAATRADASSLAMSFTEGVYV
GHSWNPFFIHGVKLIAYELALELGNIDNVVAPLGNGTLTLGLYLGFKEAEELKLIKDTPR
IIAVEASGYEWAYSMLHNTPMGVKATLPDGIIVPQPPRLTQIIDAIRDTGGDVVVVNDQG
VIEGLREGIRLGFIIEPTSAVVFKALKEVNLSGTTVVILTGSGLKLSNELYRLIYGE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttaacttaactaacatgagcggggaggtaacgtacaagtgccctaaatgcggc
ttcacaaccgaggctaatacctggcttatcaagtgccctagatgcgggtcaccgttgaat
gtgaattatgatttaaggagacctagggagcttagtagaagtgaattaacgaggattcta
cctgttaaggagccgttaagccttggtgaaggtttaaccccactggttaggaggggtgat
tactactttaagcttgagtaccttaaccccactggttcatttaaggatagggggtggagt
cttgccctatcagtactacgtaatgacgtcactgtggttgaggattcaagcggtaatgct
ggactatccctagcagcatactccgcggttaagggggttagggctaggatttacgtccct
aagacggcccctgaggctaagaagagacttatgaggctcctaggcgctaatgtggttgag
gctgcaactagggctgatgcatcatcacttgccatgagcttcacagagggggtttacgtt
ggtcattcatggaaccccttcttcatacatggcgttaagttaatagcttatgaactagca
ttagaattagggaacattgataatgttgttgcacccctaggtaacggtaccttaacccta
ggcctatacttaggtttcaaggaggctgaggaattgaagcttattaaagacacacctagg
ataatagccgttgaggcatcaggctacgagtgggcttacagtatgcttcacaacacaccc
atgggtgttaaggcaaccttacccgacggcataatagtgccccagccacctaggttaact
cagataattgacgcgatacgggacactggaggtgacgtggtggttgttaatgatcagggg
gttattgaggggttaagggagggtattaggttagggttcataattgagccaacaagcgca
gttgtctttaaggcccttaaggaagtgaacctaagtggcacaactgtagttattttaacg
ggttcaggcttaaagctgagtaatgaactgtatcggttaatatacggtgaatga

DBGET integrated database retrieval system