KEGG   Caldivirga maquilingensis: Cmaq_1151Help
Entry
Cmaq_1151         CDS       T00611                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1151
   01230 Biosynthesis of amino acids
    Cmaq_1151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1151
   00030 Pentose phosphate pathway
    Cmaq_1151
   00051 Fructose and mannose metabolism
    Cmaq_1151
  Energy metabolism
   00680 Methane metabolism
    Cmaq_1151
Enzymes [BR:cma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Cmaq_1151
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Cmaq_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1206841..1208049
Genome map
AA seq 402 aa AA seqDB search
MAPKTTVSVIKADIGGIPGHAWVHPKILEYASSRLREAVKSGLLIDYYVFNVGDDMSLLM
THTKGIDNPEIHGLAWSVFKEATENYAKKFKLYGAGQDLLKDSFSGNVRGLGPQVAEMEF
EERPSEPLIIFAADKTEPGAYNLPMYKIFADPFNTAGLVIDPQMHGGFRFEIIDVYEGKV
YLLDAPEHIYTILGLIGTPGRYIIRRVYRRSDLTQAAVVSVERLNLIAGRYVGKDDPVAI
VRAQHGLPAVGEVLEAFALPHLVEGWMRGSHTGPLMPGKFVSIDPANKIAMGPKMTRFDG
PPKVGALGFQLHEGYLEGPVDMFDDPAFDFSRQIAAFITDYIRRMGPIMPHRLPPEEMEY
TTLPQILSTLKPIPVEEYERNRLKYISEKISPVAIAGGSTGD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaaaaccaccgtatcagtaataaaggctgatattgggggaatacctggtcat
gcttgggttcacccaaagatacttgaatacgccagtagtaggcttagggaggctgttaag
agtggattactaattgattactacgtgtttaatgttggcgacgacatgagcctcctaatg
actcacactaagggtattgataaccctgagatacatggattagcgtggagtgtattcaag
gaggctactgagaattacgccaagaagtttaagctatatggtgctgggcaggacttactt
aaggatagcttcagcggtaacgtgagggggcttggaccccaggttgctgaaatggagttt
gaggagaggcccagtgaaccattaataatcttcgcagcggataagactgagccgggtgca
tacaacttacccatgtataagatatttgcagacccatttaacaccgctggcttagttatt
gatcctcagatgcatggtggatttaggttcgagataatagatgtttacgagggtaaggtt
tacctactcgatgccccagagcacatatacactatacttggcttaataggcacacctgga
agatacattattaggagggtttacaggaggagtgacttaacccaggcagcggttgtgagc
gttgagaggcttaacctaatagccggtaggtacgtgggtaaggatgacccagtggccata
gttagggctcaacacggcctaccagccgtgggtgaggtccttgaagcattcgccctaccc
cacctggtggagggttggatgaggggtagtcacactggcccattaatgccaggtaagttc
gtaagcattgacccagctaataagatagccatgggtcctaagatgactaggttcgatgga
ccacccaaggtcggtgccttaggcttccaactacatgaaggctacctagagggacccgtg
gacatgttcgatgacccagccttcgactttagcagacaaatagcagccttcataacagac
tacattaggagaatggggccaataatgccgcacaggctaccaccggaggagatggagtac
acgaccctaccgcaaatactatcaacgcttaaaccaatcccggttgaggagtatgagagg
aataggttaaagtacataagcgagaaaattagcccagtagccatagctggaggaagtacc
ggtgactga

DBGET integrated database retrieval system