KEGG   Caldivirga maquilingensis: Cmaq_1151Help
Entry
Cmaq_1151         CDS       T00611                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cma00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cma00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cma00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:cma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1206841..1208049
Genome map
AA seq 402 aa AA seqDB search
MAPKTTVSVIKADIGGIPGHAWVHPKILEYASSRLREAVKSGLLIDYYVFNVGDDMSLLM
THTKGIDNPEIHGLAWSVFKEATENYAKKFKLYGAGQDLLKDSFSGNVRGLGPQVAEMEF
EERPSEPLIIFAADKTEPGAYNLPMYKIFADPFNTAGLVIDPQMHGGFRFEIIDVYEGKV
YLLDAPEHIYTILGLIGTPGRYIIRRVYRRSDLTQAAVVSVERLNLIAGRYVGKDDPVAI
VRAQHGLPAVGEVLEAFALPHLVEGWMRGSHTGPLMPGKFVSIDPANKIAMGPKMTRFDG
PPKVGALGFQLHEGYLEGPVDMFDDPAFDFSRQIAAFITDYIRRMGPIMPHRLPPEEMEY
TTLPQILSTLKPIPVEEYERNRLKYISEKISPVAIAGGSTGD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaaaaccaccgtatcagtaataaaggctgatattgggggaatacctggtcat
gcttgggttcacccaaagatacttgaatacgccagtagtaggcttagggaggctgttaag
agtggattactaattgattactacgtgtttaatgttggcgacgacatgagcctcctaatg
actcacactaagggtattgataaccctgagatacatggattagcgtggagtgtattcaag
gaggctactgagaattacgccaagaagtttaagctatatggtgctgggcaggacttactt
aaggatagcttcagcggtaacgtgagggggcttggaccccaggttgctgaaatggagttt
gaggagaggcccagtgaaccattaataatcttcgcagcggataagactgagccgggtgca
tacaacttacccatgtataagatatttgcagacccatttaacaccgctggcttagttatt
gatcctcagatgcatggtggatttaggttcgagataatagatgtttacgagggtaaggtt
tacctactcgatgccccagagcacatatacactatacttggcttaataggcacacctgga
agatacattattaggagggtttacaggaggagtgacttaacccaggcagcggttgtgagc
gttgagaggcttaacctaatagccggtaggtacgtgggtaaggatgacccagtggccata
gttagggctcaacacggcctaccagccgtgggtgaggtccttgaagcattcgccctaccc
cacctggtggagggttggatgaggggtagtcacactggcccattaatgccaggtaagttc
gtaagcattgacccagctaataagatagccatgggtcctaagatgactaggttcgatgga
ccacccaaggtcggtgccttaggcttccaactacatgaaggctacctagagggacccgtg
gacatgttcgatgacccagccttcgactttagcagacaaatagcagccttcataacagac
tacattaggagaatggggccaataatgccgcacaggctaccaccggaggagatggagtac
acgaccctaccgcaaatactatcaacgcttaaaccaatcccggttgaggagtatgagagg
aataggttaaagtacataagcgagaaaattagcccagtagccatagctggaggaagtacc
ggtgactga

DBGET integrated database retrieval system