KEGG   Caldivirga maquilingensis: Cmaq_1175Help
Entry
Cmaq_1175         CDS       T00611                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cmaq_1175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1175
  Lipid metabolism
   00071 Fatty acid degradation
    Cmaq_1175
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cmaq_1175
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cmaq_1175
   00626 Naphthalene degradation
    Cmaq_1175
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cmaq_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1233599..1234639
Genome map
AA seq 346 aa AA seqDB search
MRARALVLREFSGRLRLESIDVKEPGNDESVLVKVIGAGMCKTDVRLWKGTEPREGFKLP
FVLGHENAGIVEEVGGKVKGLKPGDKVLVYAIWADPGCKYCRVGKCMQCRDQSIPGQSNY
YGGYAEYLYVPDYRYLVRIDIDPVETAPLADAGLTSYSAVKKSIPYLYPGSLVIVYGMGG
LASYAVQYLRKMTPYVTVVAVSRSDDKLKWAEELGAHYAVHPSELASIVKSVSTDGASIL
LDFVGNEESAKAVSLLEPGGAVVLVGMEGKSYPIPVFDTVAWQYTVIGSNYGSINEMEEM
VKFIKDHGVKSYIEKIPLSEGDVNDALVKLSEGKVLGRFVITPWGG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagggctagggccttagtcctaagggaattcagtgggaggcttaggcttgagtccatt
gatgttaaggaacccggtaatgatgagtcagtgttagttaaggttattggagctggaatg
tgtaagacagatgttaggctatggaagggtactgagcctagggagggctttaaactaccc
ttcgtcctaggtcatgagaacgcgggcatagtggaggaggttgggggtaaggttaagggg
cttaagccgggggataaggtacttgtatacgcaatttgggctgacccaggctgcaaatac
tgtagggtgggtaagtgcatgcagtgtagggatcaaagcataccaggtcaatcaaactac
tacggtgggtatgcggagtacctttacgtaccggattacaggtatttagtgaggatagac
attgatccagttgagacagcccccttagctgacgctggtttaacatcatactcagcggtt
aagaagagtataccgtatctttacccaggttcactggtgatagtttacggtatgggtggc
ttagcctcatatgcagtgcagtaccttaggaaaatgaccccatacgtcaccgttgtggcc
gtatcgaggagtgatgataagcttaagtgggctgaggaattaggcgcccactatgccgtt
cacccaagtgaattagccagtattgttaagagcgtcagcactgatggtgcctcaattctc
ctcgacttcgttggcaatgaggagtccgctaaggcagtgtcattacttgagccgggtggt
gcagtggtgttggttggcatggagggtaaatcatacccaatccccgtcttcgatactgtt
gcctggcagtacacggttattgggagtaattacggtagtattaatgagatggaggagatg
gttaagttcattaaggatcatggggttaagtcatatattgagaagataccgttaagcgag
ggggatgttaacgatgccttagttaaattaagtgagggtaaggtgcttggaagattcgtg
ataacaccatggggtggttaa

DBGET integrated database retrieval system