KEGG   Caldivirga maquilingensis: Cmaq_1175Help
Entry
Cmaq_1175         CDS       T00611                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K19590  
D-arabinose 1-dehydrogenase [EC:1.1.1.117]
Organism
cma  Caldivirga maquilingensis
Brite
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.117  D-arabinose 1-dehydrogenase [NAD(P)+]
     Cmaq_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1233599..1234639
Genome map
AA seq 346 aa AA seqDB search
MRARALVLREFSGRLRLESIDVKEPGNDESVLVKVIGAGMCKTDVRLWKGTEPREGFKLP
FVLGHENAGIVEEVGGKVKGLKPGDKVLVYAIWADPGCKYCRVGKCMQCRDQSIPGQSNY
YGGYAEYLYVPDYRYLVRIDIDPVETAPLADAGLTSYSAVKKSIPYLYPGSLVIVYGMGG
LASYAVQYLRKMTPYVTVVAVSRSDDKLKWAEELGAHYAVHPSELASIVKSVSTDGASIL
LDFVGNEESAKAVSLLEPGGAVVLVGMEGKSYPIPVFDTVAWQYTVIGSNYGSINEMEEM
VKFIKDHGVKSYIEKIPLSEGDVNDALVKLSEGKVLGRFVITPWGG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagggctagggccttagtcctaagggaattcagtgggaggcttaggcttgagtccatt
gatgttaaggaacccggtaatgatgagtcagtgttagttaaggttattggagctggaatg
tgtaagacagatgttaggctatggaagggtactgagcctagggagggctttaaactaccc
ttcgtcctaggtcatgagaacgcgggcatagtggaggaggttgggggtaaggttaagggg
cttaagccgggggataaggtacttgtatacgcaatttgggctgacccaggctgcaaatac
tgtagggtgggtaagtgcatgcagtgtagggatcaaagcataccaggtcaatcaaactac
tacggtgggtatgcggagtacctttacgtaccggattacaggtatttagtgaggatagac
attgatccagttgagacagcccccttagctgacgctggtttaacatcatactcagcggtt
aagaagagtataccgtatctttacccaggttcactggtgatagtttacggtatgggtggc
ttagcctcatatgcagtgcagtaccttaggaaaatgaccccatacgtcaccgttgtggcc
gtatcgaggagtgatgataagcttaagtgggctgaggaattaggcgcccactatgccgtt
cacccaagtgaattagccagtattgttaagagcgtcagcactgatggtgcctcaattctc
ctcgacttcgttggcaatgaggagtccgctaaggcagtgtcattacttgagccgggtggt
gcagtggtgttggttggcatggagggtaaatcatacccaatccccgtcttcgatactgtt
gcctggcagtacacggttattgggagtaattacggtagtattaatgagatggaggagatg
gttaagttcattaaggatcatggggttaagtcatatattgagaagataccgttaagcgag
ggggatgttaacgatgccttagttaaattaagtgagggtaaggtgcttggaagattcgtg
ataacaccatggggtggttaa

DBGET integrated database retrieval system