KEGG   Caldivirga maquilingensis: Cmaq_1220Help
Entry
Cmaq_1220         CDS       T00611                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cma  Caldivirga maquilingensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1220
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cmaq_1220
   00640 Propanoate metabolism
    Cmaq_1220
   00660 C5-Branched dibasic acid metabolism
    Cmaq_1220
Enzymes [BR:cma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cmaq_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1291405..1292538
Genome map
AA seq 377 aa AA seqDB search
MRLLEYKGKEILAKYGVSVPKGVVISSVSDIDKSNLKYPVFVKSQVPFAGRAKMGLVKRA
NNKDEAKQIASEYLGKVIQDFEVKKVLLEEGVDVVKEYYVSVTIDRSSRTFIILASPEGG
VDIEEIARTSPEKIYRGRIHPFEGLRDYTVNAINKFMGFTGELASKFASLLRIMYNVFET
YDAELVEINPLALTRDGNFVALDVKIMIDDNALYRHGDISVEEEGDLTREELEARKYGFH
YVELPGYVGVVGNGAGLTMATMDLVKEFKGEPADFLDVGGGASRDIVKAALSLLLKDERI
KGIVLNIFGGITRGDEVAYGVVEAFKEIGASKPLAIRLKGTNEEEGRRILAPLGVKIYET
AEEAIGELMSKLQGGSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaggctacttgagtataagggtaaggagatactggctaagtatggtgtaagcgtgcct
aaaggtgttgtaatcagtagcgtgagcgacattgataagagtaacctaaagtacccagta
ttcgttaagtcccaggtacccttcgcaggtagggctaagatggggcttgttaagagggct
aataataaggatgaggctaagcaaatagcttcagagtacttgggtaaggttattcaggac
tttgaggttaagaaggttctacttgaggagggggttgatgttgttaaggagtactacgtc
tcagtaaccatagatagatccagtaggacattcataatcctggcctcacctgagggtggg
gttgatatagaggagatagctaggacaagtcctgagaaaatatacaggggtaggatccat
ccctttgagggtcttagggactacactgttaacgctattaataagttcatgggcttcaca
ggggagttagcctcaaaattcgcctcactccttagaataatgtacaacgtgtttgaaact
tatgatgctgaattagtggagattaatccacttgccttaacaagggacggtaacttcgtt
gcccttgatgttaaaataatgatcgatgacaatgcactatataggcatggtgatatttca
gtggaggaggagggtgacttaaccagggaggagcttgaggctaggaagtacggcttccac
tacgttgagttaccgggctacgtgggtgttgttggtaatggggctggtttaacaatggcc
acaatggatcttgttaaggagtttaagggtgaaccagctgacttccttgacgttgggggt
ggtgcaagtagggatattgttaaggcagccttaagcctactacttaaggatgagaggatt
aagggaatcgtattaaatatcttcggtggaataaccaggggagatgaggttgcctacggt
gtcgtggaggcctttaaggagattggcgcctctaagccattggcaataaggctgaaggga
accaatgaggaggagggtaggaggattctagccccattgggggttaaaatttatgaaaca
gccgaggaggctataggtgaattaatgagtaaactacagggtggttcaagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system