KEGG   Caldivirga maquilingensis: Cmaq_1220Help
Entry
Cmaq_1220         CDS       T00611                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cma  Caldivirga maquilingensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1220
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cmaq_1220
   00640 Propanoate metabolism
    Cmaq_1220
   00660 C5-Branched dibasic acid metabolism
    Cmaq_1220
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cmaq_1220
Enzymes [BR:cma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cmaq_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1291405..1292538
Genome map
AA seq 377 aa AA seqDB search
MRLLEYKGKEILAKYGVSVPKGVVISSVSDIDKSNLKYPVFVKSQVPFAGRAKMGLVKRA
NNKDEAKQIASEYLGKVIQDFEVKKVLLEEGVDVVKEYYVSVTIDRSSRTFIILASPEGG
VDIEEIARTSPEKIYRGRIHPFEGLRDYTVNAINKFMGFTGELASKFASLLRIMYNVFET
YDAELVEINPLALTRDGNFVALDVKIMIDDNALYRHGDISVEEEGDLTREELEARKYGFH
YVELPGYVGVVGNGAGLTMATMDLVKEFKGEPADFLDVGGGASRDIVKAALSLLLKDERI
KGIVLNIFGGITRGDEVAYGVVEAFKEIGASKPLAIRLKGTNEEEGRRILAPLGVKIYET
AEEAIGELMSKLQGGSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaggctacttgagtataagggtaaggagatactggctaagtatggtgtaagcgtgcct
aaaggtgttgtaatcagtagcgtgagcgacattgataagagtaacctaaagtacccagta
ttcgttaagtcccaggtacccttcgcaggtagggctaagatggggcttgttaagagggct
aataataaggatgaggctaagcaaatagcttcagagtacttgggtaaggttattcaggac
tttgaggttaagaaggttctacttgaggagggggttgatgttgttaaggagtactacgtc
tcagtaaccatagatagatccagtaggacattcataatcctggcctcacctgagggtggg
gttgatatagaggagatagctaggacaagtcctgagaaaatatacaggggtaggatccat
ccctttgagggtcttagggactacactgttaacgctattaataagttcatgggcttcaca
ggggagttagcctcaaaattcgcctcactccttagaataatgtacaacgtgtttgaaact
tatgatgctgaattagtggagattaatccacttgccttaacaagggacggtaacttcgtt
gcccttgatgttaaaataatgatcgatgacaatgcactatataggcatggtgatatttca
gtggaggaggagggtgacttaaccagggaggagcttgaggctaggaagtacggcttccac
tacgttgagttaccgggctacgtgggtgttgttggtaatggggctggtttaacaatggcc
acaatggatcttgttaaggagtttaagggtgaaccagctgacttccttgacgttgggggt
ggtgcaagtagggatattgttaaggcagccttaagcctactacttaaggatgagaggatt
aagggaatcgtattaaatatcttcggtggaataaccaggggagatgaggttgcctacggt
gtcgtggaggcctttaaggagattggcgcctctaagccattggcaataaggctgaaggga
accaatgaggaggagggtaggaggattctagccccattgggggttaaaatttatgaaaca
gccgaggaggctataggtgaattaatgagtaaactacagggtggttcaagatga

DBGET integrated database retrieval system