KEGG   Caldivirga maquilingensis: Cmaq_1260Help
Entry
Cmaq_1260         CDS       T00611                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cma  Caldivirga maquilingensis
Pathway
cma00010  Glycolysis / Gluconeogenesis
cma00030  Pentose phosphate pathway
cma00051  Fructose and mannose metabolism
cma00052  Galactose metabolism
cma00680  Methane metabolism
cma01100  Metabolic pathways
cma01110  Biosynthesis of secondary metabolites
cma01120  Microbial metabolism in diverse environments
cma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1260
   00030 Pentose phosphate pathway
    Cmaq_1260
   00051 Fructose and mannose metabolism
    Cmaq_1260
   00052 Galactose metabolism
    Cmaq_1260
  Energy metabolism
   00680 Methane metabolism
    Cmaq_1260
Enzymes [BR:cma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cmaq_1260
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cmaq_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Glyco_transf_4 Bmp
Motif
Other DBs
NCBI-ProteinID: ABW02087
JGI: Cmaq1260
UniProt: A8ME81
Position
1331875..1332885
Genome map
AA seq 336 aa AA seqDB search
MRIGVLTGGGDAPGLNIAVYSFIKLAERNHEVYVIYHGWRGLLEREVRRITSLDLVDFAF
SGGTYIKTSRTNPFKDEERARLLERNVKELGLDVVVAIGGDDTLGAAGEAQRRGILNAVG
IPKTIDNDVFGTDFTIGFDSAVNAAVNVTESFKTTLISHERIGVVEVMGREAGWVALHTG
LATMADATLIPEKQVSWDSVVRRVKEAYEKKHWALVVVSEGIKEYEGPRDEFGHARLGGV
GNELADYIEKATGIETRAVIPGHIIRGVSPSAFDRTLAIRYATAAYEAIENDRFGIMVAY
SNGELTHVPIVEVVGKNKLVSGYWLRLYETYWGDLN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaggattggagtattgactggaggtggggatgcccctgggttaaatattgctgtttac
tctttcattaagttggctgagaggaatcatgaggtttatgtaatataccatggttggagg
gggttgcttgagagggaggttaggagaataacgtcactggacctagtggacttcgccttc
tcaggtggaacatacattaagacctctaggactaatccatttaaggatgaggagagggct
aggttacttgagaggaatgttaaggaactcggcctagatgttgtagtggctattggcggt
gatgatacattgggtgccgcaggtgaggcgcagaggaggggtatattgaatgcagtgggt
attcctaagactattgataatgatgtttttggtactgattttactattggttttgattct
gctgttaatgctgctgttaatgttactgagtcctttaaaaccaccttaatctcccatgag
aggattggtgtagtggaggttatgggtagggaggctggatgggtagcattacacactgga
ctagcaacaatggcagacgcaacactaataccggagaagcaggttagttgggattcagtg
gtaaggagggttaaggaggcctacgagaagaagcactgggccctcgttgtggtttcagag
ggtattaaggagtacgaggggccaagggatgaattcggccatgctaggcttggcggtgta
ggtaatgagttagctgattacattgaaaaggccactggaatagagactagggcagttata
ccagggcatataataaggggtgtgtctccatcagccttcgataggactctagccataaga
tacgccacagccgcctatgaggctattgagaacgatagattcggcataatggtggcctac
agtaacggtgagttaacgcacgtgcccattgttgaggttgtgggtaagaataagctagtt
agtggttattggttaaggctctatgaaacctactggggggacttaaattaa

DBGET integrated database retrieval system