KEGG   Caldivirga maquilingensis: Cmaq_1318Help
Entry
Cmaq_1318         CDS       T00611                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
cma  Caldivirga maquilingensis
Brite
Enzymes [BR:cma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Cmaq_1318
Transfer RNA biogenesis [BR:cma03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Cmaq_1318
Chromosome and associated proteins [BR:cma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Cmaq_1318
   HAT complexes
    Elongator complex
     Cmaq_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ABW02144
JGI: Cmaq1318
UniProt: A8M8S5
Position
1393603..1395135
Genome map
AA seq 510 aa AA seqDB search
MVGKGMVAKGRFFSGVKKPVRVISGVTPLAVMTAPLPCPGKCIYCPGGPQMNTPKSYLPD
SPVPMRAARVNYDPYMQVASRITQYRAMGHPVSKVEVIVMGGTFTALPLNYQYWFILNIY
RALNDYPVWRGSSPLGDLELEESRNEDASARVVALTIETRPDFALEKQVNWMISFGATRV
ELGVQSIYDDVLSRVKRGHGVAEVVKSTRVLKDSAYKVCYHVMPGLPGSDPDRDLAMIDE
LFSNPDFKPDCVKIYPTLVIPGTELYEMWRRGEYSSYSEDTWLTLLAKVMAKVPRWVRVM
RFGRDIPLHWVVDGPRIGNLREEVWARMRQMGLKCLEIRCREVGHRILENGELPKATTLR
INRINYEASGGDEVYLEVIDDEDTLYGILRLRIPSNPHRPELRGRTALVRELHVYGPQVM
VGSRPVNQLWWQHRGIGRALMAKAEEVAEEYGALRIAVISGVGVREYYRRLGYRKYPGSI
YMIKDLRKGMRIEYNLNSDVVMPSEYLVMD
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtggttggtaagggtatggttgctaaggggaggttcttcagtggggttaagaagcctgtg
agggttatttcaggggtaaccccattagccgtaatgacggctccattaccctgcccaggt
aaatgcatctactgccccggcggccctcagatgaatacgccgaagagttacctacctgat
tcaccagtacccatgagggcggctagggttaattacgacccttacatgcaggttgcctca
aggattacccagtatagggctatgggtcaccctgttagtaaggttgaggttattgtaatg
ggtggaaccttcactgcactgccactcaattaccagtactggttcattttaaacatctac
agggcgttgaacgactacccagtttggaggggttcctctcccttaggtgacctggagctt
gaggagagtaggaatgaggatgcctcagctagggttgttgcattaaccatagagactagg
cctgacttcgcccttgagaagcaggttaactggatgattagcttcggcgcaactagggtt
gaattgggtgttcagtctatttacgatgacgtgttgagtagggttaagaggggtcatggc
gtcgcggaggttgttaaatccactagggtgttgaaggactcagcctacaaggtgtgttac
cacgttatgcctggcctaccgggctctgaccctgatagggacttagccatgattgatgaa
ttattcagtaaccctgactttaagcctgattgcgtaaaaatctacccaacactggttata
cctggcactgagctttatgaaatgtggcgtaggggtgagtactcaagctacagtgaggat
acttggttaaccctactggctaaggtaatggctaaggtacctaggtgggttagggtcatg
aggtttggtagggatataccactgcattgggttgttgatggaccaaggataggtaacctg
agggaggaggtttgggctaggatgaggcaaatgggtcttaaatgccttgagataaggtgc
cgtgaagtcgggcataggatacttgagaatggtgagttacccaaagccacgacacttagg
atcaataggattaactacgaggcctcagggggtgatgaagtttacctagaggtcattgat
gacgaggacactttatacgggatattgagactaagaatacccagtaatccccataggcct
gaattaaggggaaggactgcattagtcagggagcttcacgtatatgggccgcaggtcatg
gttggtagcaggccggttaatcaactttggtggcagcataggggtattgggagggcctta
atggctaaggctgaggaggtggctgaggagtacggtgcattaaggatagccgtaatatca
ggtgtgggtgtgagggagtattataggaggcttggatacaggaaatacccaggttcaata
tacatgattaaggacttaaggaaaggaatgaggattgaatataacttaaatagtgacgta
gtaatgccgagtgaatacttagtaatggattaa

DBGET integrated database retrieval system