KEGG   Caldivirga maquilingensis: Cmaq_1543Help
Entry
Cmaq_1543         CDS       T00611                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cma  Caldivirga maquilingensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1624647..1625564
Genome map
AA seq 305 aa AA seqDB search
MSNLRNDPPFLRKSMYKFIKDPGDVRIGEVVKRDWISGDVGILGVPWDGAVGTRPGSRLA
PSRIRSLLYTQPYTFHDLTIIDFGDVDVVIGDHNETWRRTEATVSEALGLVKELIVIGGD
STISYATFRGLRRTTDNLAYILFDAHPDVRLVDEGLTSGQVVRWIRSISSNAYIAIIGVR
KYSNAPYLFSESEKLGIKVYTMDQVDSMGIEAVVNDIENNVKNRITHVSINLDVVDPAFA
PGVNSPSPGGFTSREVIRIIAELSRRIRPRVFDVVEVTPPFDNNDLTSMLASVIIMNAIW
VKQLP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaaggaatgatccacctttcttaaggaaatccatgtataagttcattaag
gatcctggtgatgttaggattggtgaggttgttaaaagggattggattagtggggacgtg
ggaatactgggtgtaccatgggatggggcagtgggtactaggcctggttccagacttgcc
ccatctagaattagaagccttctctatactcaaccttacacatttcatgacttaaccatt
attgatttcggtgatgttgatgttgttattggtgaccacaatgagacttggcgtagaacc
gaggccactgtttctgaggctttaggcttagttaaggagcttatcgtcattggtggtgat
agtacaatatcctacgctactttcaggggcttgaggaggaccactgataacttagcttac
atactttttgatgctcacccagatgttagactggtggatgagggattaaccagtggtcaa
gtggttagatggattaggagtattagttcaaacgcgtatattgctataattggggttagg
aaatactcaaatgcaccctacctattcagtgaatctgagaagttgggaatcaaggtctat
actatggatcaagtggactcaatgggtatagaagccgtggtgaatgatattgagaataat
gtgaagaataggatcacccatgtgagcattaaccttgatgttgttgatccagccttcgcc
ccaggcgttaatagtccatcaccagggggattcacttcaagggaagtaattaggattatt
gcggaattaagtaggagaataaggcctagggtttttgatgttgttgaggttacgccaccc
tttgataataatgatttaacaagtatgctggcttcagtaataataatgaatgcaatatgg
gttaagcaattgccttaa

DBGET integrated database retrieval system