KEGG   Caldivirga maquilingensis: Cmaq_1688Help
Entry
Cmaq_1688         CDS       T00611                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1688
   00030 Pentose phosphate pathway
    Cmaq_1688
   00051 Fructose and mannose metabolism
    Cmaq_1688
   00052 Galactose metabolism
    Cmaq_1688
   00500 Starch and sucrose metabolism
    Cmaq_1688
   00520 Amino sugar and nucleotide sugar metabolism
    Cmaq_1688
  Nucleotide metabolism
   00230 Purine metabolism
    Cmaq_1688
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cmaq_1688
Enzymes [BR:cma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Cmaq_1688
    5.4.2.8  phosphomannomutase
     Cmaq_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1765475..1766872
Genome map
AA seq 465 aa AA seqDB search
MVNVGKLFGTNGVRLEFTKGNYDPGFLVKLAGAVATYVNAGDVLLGFDVRVTSLPLVGVL
YGVLSMYGINVDVIGPLPTPIHQYLTKAWGYRAGIMVTASHNPPHYNGIKLMDSNGVEVS
RRVEEEVETIFFNGRYKETVDYRDIGAVRFINVEEGLRDYRDHLLSIINDEPIRRRGFRI
VADFANSVNSIALSYVLRGLNVKVYSINGHLDGEFPGRNPEPRPENLNVASRAVVESSAD
FGVAYDGDGDRSLFIDEKGNVIWGDRTGTILALSMIKNGDKVVTPVSSSVVVKWAVEGAG
GRVIWTRVGSVDVSHKVIEEGALCGFEDNGGFIWPKHHPVRDGVSTTLLMMKVLSEEKAK
LSELNARMPAMLTARERMEMSRDLAGKIVEALKGRNWGGEVITIDGLRVNYTDSWFLVRP
SGTENLLRVVIEASSSDRFNTLRHEVMNSIEKELKKYSGVTSNTE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtggttaatgtgggtaaactattcggtaccaatggggttagactggagttcactaagggt
aactatgacccaggtttcctagttaagttagcaggggctgtggcaacctacgttaatgct
ggtgatgtactactgggcttcgacgttagggtaacaagcctaccactagtgggggtgctt
tatggagtattgtcaatgtatggtattaacgttgatgtaataggaccattaccaacccca
atacaccagtacttaaccaaggcctggggttatagggccggcataatggtgactgccagt
cataatccaccacattacaatggtattaagctaatggatagtaatggtgttgaagtaagc
aggagggttgaggaggaggtggagacaatattcttcaacggcaggtataaggagactgtg
gattatagggatattggagcagtcagattcattaatgttgaggaggggttaagggattat
agggatcatttactaagcataattaatgatgaaccaattaggcgtaggggattcagaata
gtggctgacttcgccaatagtgttaattcaatagccctctcatacgttttaaggggactt
aacgtaaaggtttactcaatcaacggccaccttgatggtgaattcccaggtaggaaccct
gaaccaaggcctgagaaccttaacgtagcatcaagggctgttgttgaatccagcgccgac
ttcggtgttgcctatgatggtgatggtgataggtcactcttcattgatgagaagggtaat
gtaatatggggggataggacaggtactattcttgcattatccatgattaagaatggcgat
aaggttgttacaccagtgtcatcaagcgtggttgttaagtgggctgtggagggggctggt
ggtagggttatttggactagggttggttcagttgacgttagtcataaggttattgaggag
ggggcgttatgcggctttgaggataatggtggattcatatggcctaaacaccacccggtg
agggatggtgtatcaacaacgttactaatgatgaaagtcctatctgaggaaaaggctaag
ttatctgagcttaatgcgagaatgccagcaatgttaactgcaagggagagaatggagatg
agtagggatcttgcaggaaagatcgttgaggcacttaagggtaggaattggggtggtgaa
gtcattaccatagatggactcagggttaattacacggactcctggttcctagtaaggcca
agcggcactgagaatctactcagggtggtaattgaagcatcaagtagtgacagattcaat
acccttaggcatgaggtaatgaacagtatagagaaggaacttaagaaatacagcggagta
acatcaaacacagagtaa

DBGET integrated database retrieval system