KEGG   Caldivirga maquilingensis: Cmaq_1710Help
Entry
Cmaq_1710         CDS       T00611                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1710
   00020 Citrate cycle (TCA cycle)
    Cmaq_1710
   00620 Pyruvate metabolism
    Cmaq_1710
   00640 Propanoate metabolism
    Cmaq_1710
   00650 Butanoate metabolism
    Cmaq_1710
  Energy metabolism
   00680 Methane metabolism
    Cmaq_1710
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cmaq_1710
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cmaq_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1788151..1788717
Genome map
AA seq 188 aa AA seqDB search
MQMLISDTRELIILGRGGQGGVTAARIIVSAATRDGKWGQAIPEFGAERRGAIVKSYARI
SSKPVISHSGVKKADILLILSPDILNLINISELMKGRDSVIIINSPTSIRTGYRTYWVDA
TGISEKLGLVMAGWHIVSTPILGAFVRVTELVTLDSVISSIGEFVGRGDYVKLNIEAVKM
GYSMVKGD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgctaattagtgatactagggaattaataatacttggtagaggggggcagggt
ggggtaaccgccgctaggataatagtatctgcagccaccagggatggtaaatgggggcaa
gcaatacctgaattcggtgctgaaaggaggggtgctattgttaagtcatatgcaagaata
tcaagtaagccagtgatctcgcatagtggggttaagaaggccgacatactacttatacta
tctcccgacatactgaacctcattaacattagtgaattaatgaaggggcgggattcagtc
ataataattaactcccctacatcaataaggacaggctatagaacgtattgggtggatgca
accgggataagtgagaaattaggtttagtgatggctggttggcacatagtgagtacacca
atattaggtgcatttgtaagggttactgaattagttacactggattcggtaatatcatct
ataggtgaattcgtagggaggggtgattacgttaaattgaacatagaggctgttaagatg
gggtacagtatggttaagggtgattaa

DBGET integrated database retrieval system