KEGG   Caldivirga maquilingensis: Cmaq_1713Help
Entry
Cmaq_1713         CDS       T00611                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1713
   00020 Citrate cycle (TCA cycle)
    Cmaq_1713
   00620 Pyruvate metabolism
    Cmaq_1713
   00640 Propanoate metabolism
    Cmaq_1713
   00650 Butanoate metabolism
    Cmaq_1713
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cmaq_1713
   00680 Methane metabolism
    Cmaq_1713
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cmaq_1713
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cmaq_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1790215..1791129
Genome map
AA seq 304 aa AA seqDB search
MVTMSELHKYGRTKVIMPGTAACPGCPLQIGLRQLIMALEGKLTLVIPAGCSSVIPGAAP
YTSFTVPVMHVPFASSPSVASGLVRALRARGVDGHVVVWAGDGATADIGFAALSGAAYRN
EDIIYVLADNEAYMNTGIQASGTTPRKAWTTTSPRGKTEGKKEVALIMLMHKVPYVATAS
IAYPIDFIDKVRRAASIRGFKFIHLHAPCPPGWKFPDDYTVKVARLAVETGMWVLWEYYQ
GKLTISPPSVPYKDKKRRKPIEEYLRIQGRFAHLSRDDINEIEAMVDQEWETLMSLANIL
NNHA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtcactatgagtgaacttcacaaatatgggagaactaaggtaataatgcccggtaca
gcagcatgcccaggttgcccacttcaaataggcttaaggcaattaataatggcattggag
gggaagttaaccctcgtcatacctgccgggtgctcaagcgtaatacctggagcagcacca
tacacatcattcacagtaccggttatgcatgtacccttcgcctcaagcccctcagtggcc
agtggtttagttagggctcttagggctaggggtgttgatggccacgtggttgtctgggct
ggcgacggggcaacagcggacataggtttcgctgccttaagtggggcagcctataggaat
gaggacattatctatgttttagccgataacgaggcctacatgaatactggtattcaggct
agtggaactacgcctaggaaggcttggactacaacatccccaagaggtaagactgagggt
aagaaggaggtggcgttaatcatgcttatgcataaggtaccctacgtagccacagccagt
atagcctacccaatagatttcattgataaggttaggagggcggcttcaataaggggtttc
aagttcatacaccttcatgcaccatgtccccctggttggaagttcccagatgactacaca
gttaaggtagctaggttagccgttgagactggaatgtgggtgctttgggagtattaccaa
ggtaagttaactattagtccacccagtgtcccgtataaggataagaagaggcgtaaaccc
attgaggagtaccttcgcatacagggtcgtttcgcgcacttaagtagggatgatattaat
gaaattgaggccatggttgatcaagagtgggaaacattaatgagcttagctaacatactt
aataatcacgcttaa

DBGET integrated database retrieval system