KEGG   Caldivirga maquilingensis: Cmaq_1713Help
Entry
Cmaq_1713         CDS       T00611                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cmaq_1713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1713
   00020 Citrate cycle (TCA cycle)
    Cmaq_1713
   00620 Pyruvate metabolism
    Cmaq_1713
   00640 Propanoate metabolism
    Cmaq_1713
   00650 Butanoate metabolism
    Cmaq_1713
  Energy metabolism
   00680 Methane metabolism
    Cmaq_1713
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cmaq_1713
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cmaq_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1790215..1791129
Genome map
AA seq 304 aa AA seqDB search
MVTMSELHKYGRTKVIMPGTAACPGCPLQIGLRQLIMALEGKLTLVIPAGCSSVIPGAAP
YTSFTVPVMHVPFASSPSVASGLVRALRARGVDGHVVVWAGDGATADIGFAALSGAAYRN
EDIIYVLADNEAYMNTGIQASGTTPRKAWTTTSPRGKTEGKKEVALIMLMHKVPYVATAS
IAYPIDFIDKVRRAASIRGFKFIHLHAPCPPGWKFPDDYTVKVARLAVETGMWVLWEYYQ
GKLTISPPSVPYKDKKRRKPIEEYLRIQGRFAHLSRDDINEIEAMVDQEWETLMSLANIL
NNHA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtcactatgagtgaacttcacaaatatgggagaactaaggtaataatgcccggtaca
gcagcatgcccaggttgcccacttcaaataggcttaaggcaattaataatggcattggag
gggaagttaaccctcgtcatacctgccgggtgctcaagcgtaatacctggagcagcacca
tacacatcattcacagtaccggttatgcatgtacccttcgcctcaagcccctcagtggcc
agtggtttagttagggctcttagggctaggggtgttgatggccacgtggttgtctgggct
ggcgacggggcaacagcggacataggtttcgctgccttaagtggggcagcctataggaat
gaggacattatctatgttttagccgataacgaggcctacatgaatactggtattcaggct
agtggaactacgcctaggaaggcttggactacaacatccccaagaggtaagactgagggt
aagaaggaggtggcgttaatcatgcttatgcataaggtaccctacgtagccacagccagt
atagcctacccaatagatttcattgataaggttaggagggcggcttcaataaggggtttc
aagttcatacaccttcatgcaccatgtccccctggttggaagttcccagatgactacaca
gttaaggtagctaggttagccgttgagactggaatgtgggtgctttgggagtattaccaa
ggtaagttaactattagtccacccagtgtcccgtataaggataagaagaggcgtaaaccc
attgaggagtaccttcgcatacagggtcgtttcgcgcacttaagtagggatgatattaat
gaaattgaggccatggttgatcaagagtgggaaacattaatgagcttagctaacatactt
aataatcacgcttaa

DBGET integrated database retrieval system