KEGG   Caldivirga maquilingensis: Cmaq_1719Help
Entry
Cmaq_1719         CDS       T00611                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cmaq_1719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cmaq_1719
  Lipid metabolism
   00071 Fatty acid degradation
    Cmaq_1719
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cmaq_1719
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cmaq_1719
   00626 Naphthalene degradation
    Cmaq_1719
Enzymes [BR:cma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cmaq_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1795850..1796884
Genome map
AA seq 344 aa AA seqDB search
MRAARFHESGKPLTIEEVPKPAPGPGEVIVKVMAAGVCHTELHFIDGVLNLGVAPITLGH
EIAGIVDEIGPGVSSVKPGDRVIVYYYVGCGRCRFCLRGEENLCENIKAEYGFITDGGFA
EYVKVPERNLVKLPSNLTFEEAAPIGCSVTTAIHATRRASPNVGDYVVVYGVGAVGFALI
QYNKMIGANVIAVGRSPSKLKLAKELGADYTINAGEEDVVKRVIELTNGRGADVVYELVG
IRETMNNSVRMLAKRGRLVLIGYWRDKLEVNPLDLVIKEATITASVGNTLSELIEAVKLV
SEGKIKIKVDEVVGLESINDALEKLRMGKVIGRIIINPWLIKSH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggccagattccatgaatcagggaaaccattaaccatagaggaggttcctaaa
ccagcaccaggcccaggtgaggttattgttaaagtaatggcggccggggtgtgccatact
gagctacacttcattgatggtgtacttaacctaggtgtcgcacccattactcttggtcat
gaaatagcagggatcgttgatgaaattgggccaggtgtaagcagtgttaaaccgggggat
agggtcatagtttattactatgttggatgtggtagatgtaggttctgccttagaggtgag
gagaacctatgtgagaatattaaggctgaatacggcttcataacagatggcggcttcgct
gagtatgttaaggttcctgaaagaaaccttgttaaattacccagtaacttaacctttgag
gaggctgcaccaataggctgtagtgtaacaactgctatacacgccactaggagggcttca
cctaacgtcggtgactacgtggttgtttatggtgttggcgcagttgggtttgcgttaata
cagtataataaaatgattggtgctaatgttatagcagtgggtaggagtccaagtaagctt
aagttagctaaggaacttggggctgattacactataaatgccggtgaggaggatgtagtt
aagagggttattgaattaaccaatgggaggggtgccgatgttgtgtatgagcttgttggt
attagggagactatgaataattcagttagaatgcttgccaagagaggtaggttagtgcta
ataggttactggagggataagcttgaggttaatccactggacctcgttattaaggaggcc
actataacagcatcagttggtaatacgcttagtgaactcattgaggctgttaaacttgtg
tccgagggtaagataaagataaaggttgatgaggtggtgggtttagaaagtattaatgat
gcacttgagaagcttagaatgggtaaggttattgggagaattataattaacccatggttg
attaaatcacattaa

DBGET integrated database retrieval system