KEGG   Caldivirga maquilingensis: Cmaq_1740Help
Entry
Cmaq_1740         CDS       T00611                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cma  Caldivirga maquilingensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cmaq_1740
Enzymes [BR:cma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cmaq_1740
Exosome [BR:cma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cmaq_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1817623..1818666
Genome map
AA seq 347 aa AA seqDB search
MYYRFPITRPRRLRSSRVIRNMVSETSLSPSNLVLPIFVKDEGSIEQINSMPGQYRYPIG
DELIKAINDAVESGVRAFLLFGVTKSKDPLGSLAYDKNGPVPKALRLLKENFGDSIILMT
DVCLCDYTEHGHCGVVEYRDPVQVTQTTSQPKYVVNNDATISIYAKIAVNYAEAGANVVA
PSGMMDGQVKAIREALDNNGFTDVIIMSYSSKYASTFYGPFREAADSAPRFGDRRSYQMD
PRNAYEALKEVSMDLEEGADIVMVKPAMPYLDVIRLVKQHYPEVPLAAYQVSGEYSMIKA
AALNGWLNEKMAVIESLIAIKRAGANIIITYYAKEASRWINEVESIL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtattataggttcccaatcacgaggccgagaagattaaggagtagtagggtgattagg
aacatggtttctgaaacctcactgtcgcctagtaacttggttttaccaatcttcgttaag
gatgagggttccattgagcaaataaactcaatgcccggccagtacaggtaccctattggt
gatgagttaattaaggctattaatgatgctgtggaatcgggggttagggcgttcctgctt
tttggtgttactaagagtaaggatcccttaggctcattagcctatgataagaatgggcct
gtgcctaaggcattgagactgcttaaggagaatttcggagactcaataatacttatgact
gatgtatgcttatgcgattacactgaacatgggcattgcggtgttgttgaatatagggat
ccggttcaagtcactcaaaccaccagtcagcctaagtatgttgttaataatgatgcaacc
ataagtatttacgctaagattgcggttaattacgctgaagctggagctaacgtagtggct
ccctcaggtatgatggatgggcaggttaaggctattagggaggcgcttgataataatggg
ttcactgacgtaataataatgagctatagctccaaatacgcaagcacattctatggtcca
ttcagggaggctgctgatagcgcacctaggtttggggataggcgtagttaccagatggat
cccagaaacgcttacgaagccttaaaggaggtttcaatggatcttgaggagggggctgat
atagttatggttaagcccgcgatgccttacctagacgtaattaggctagttaagcagcat
taccctgaggtacccttagcggcttaccaggtgagtggtgagtattctatgattaaggcc
gctgcattaaacggttggcttaatgaaaagatggctgtaattgagtctctaatagccata
aagagggctggggccaatataataataacctactacgctaaggaggcttcaaggtggatt
aacgaggtggagagcatcctctaa

DBGET integrated database retrieval system