KEGG   Caldivirga maquilingensis: Cmaq_1800Help
Entry
Cmaq_1800         CDS       T00611                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cma  Caldivirga maquilingensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cma00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1876202..1877800)
Genome map
AA seq 532 aa AA seqDB search
MVNLNDAGMVSGSYILAIDQGTTGTRAVLFSHDGSLIGYSYREHTQIYPKPAWVEHNPLE
IWGNTKLVIKEVIEYTRINPREIAAIGVTNQRETTVIWDPRNGQPVYNAIVWQDRRTSQM
VDYLKQNYLGMIQERTGLVPDAYFSGTKIWWLLDNVPGLRDRARRGEVVFGTIDTWIIWN
LTRGSKDVLTPERSGAHVIDYSNASRTMIFNIHKLDWDNELLEVEGKIPRDVLPLPRPSS
DKAIYGYTGPEVSQILNGVNIPVCGDAGDQQAALFGQVGFDTGEVKSTYGTGNFILMNTG
DKPVKSRMNLLTTVYYSLEEGKALYALEGSVFITGAAVQWFRDGLKAIEVSDEIEPLAAS
ASDTGGVYFVPAFVGLGAPYWDQYARGLIIGITRGTERRHIARAILESIAYLTRDVLEAM
MSDTGVKIPRIKVDGGAAKDNFLMQFQADITGIEVWRPVIFETTSLGAGYLAGLAVGFWN
NLEEIKQNWRLDKVFKPRMDPETRERLYNGWKAAVKRALGWAKEVPWAYGLG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaccttaatgatgcaggtatggttagtggtagttacatcttagccatagatcaa
gggacaacaggcactagggcagtcttattcagtcacgatggttcgttaatcggttactca
taccgtgagcacactcaaatataccctaagcctgcgtgggttgagcataatccattggag
atttgggggaatactaaactagtcattaaggaggtgatcgagtacactaggattaatcct
agggagatagcggcaattggggttactaatcagagggagaccacggttatttgggatcca
aggaatgggcaaccagtctacaatgccattgtctggcaggataggaggacgtcacagatg
gttgattaccttaagcagaattacctaggcatgattcaggagaggacaggtctcgttcct
gacgcctacttctccggtactaagatatggtggttactggataatgtgccggggcttagg
gatagggctaggaggggtgaggtggtgtttgggactattgatacttggattatctggaac
ctaactaggggtagtaaggatgtactcacccctgagaggagtggggctcacgtaattgat
tacagtaatgcgtctaggaccatgatctttaatattcataaacttgactgggataatgaa
ttacttgaggttgagggtaagataccgagggatgtactcccgttaccaaggccatcaagc
gataaggccatctacgggtacacaggccctgaagtttcccaaatactcaatggtgttaac
atacctgtatgtggggatgctggggatcagcaggcggccttattcgggcaggtgggtttt
gataccggtgaggttaagtcaacctacggtacaggtaacttcatactaatgaataccggt
gataaaccagtgaagtctaggatgaatctattaaccacggtctactactcacttgaggag
gggaaggcattatacgcacttgagggtagtgtattcatcactggtgctgcagtgcagtgg
tttagggatgggcttaaggccattgaggtttctgatgaaatagagccccttgcagccagt
gccagtgacaccggtggtgtttacttcgtaccagcattcgtcggcttaggtgcaccatac
tgggatcagtacgctaggggtttaatcattggtattacccgtggtactgagaggaggcat
attgcaagggctattctcgagtcaatagcctacttgactagggatgtgcttgaggctatg
atgagtgatactggggttaagatacctaggattaaggttgatggtggtgcagctaaggat
aatttcctaatgcagttccaagccgatattaccggtattgaggtttggaggcccgtgatt
tttgaaacaacatcactaggcgccggttacctggccggattagccgtaggcttctggaat
aatttagaggaaatcaagcagaattggaggcttgataaggtctttaaaccaaggatggat
cctgaaaccagggagaggctttacaatggatggaaggcggcggttaagagggcattaggc
tgggctaaggaggtaccgtgggcttatgggcttggttaa

DBGET integrated database retrieval system