KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00289Help
Entry
CMN_00289         CDS       T02530                                 

Gene name
agaA
Definition
hypothetical protein (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cmc00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cmc00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cmc00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(275056..277239)
Genome map
AA seq 727 aa AA seqDB search
MPDTAVPSALLHLRASGVSLVLDLTEGRLPAVVHWGAGLGDTTADDLATLALAAVEPIAG
SVADDPIRLAILPEAHTSWTGKPGLEGHRDGADWSPLFRVTSASVDGDPLPAGVDGRPGS
ASAGPALVHVDAVDEVAGLGLALDVELLPSGLVRTRAEVTNTGEGIYSVGGVTLALPLPA
EAREILDFAGRWGLERTPQRRELVVGIHEREGRKGRTGPDAATLLSVGTPGFGFRYGDVR
GVHVAFSGNHRHYAERLSTGRQVIGGGELLLPGEVRLAQGEAYASPWVYAAYGHGLDDQA
ARFHRHLRARDTHPRRDRPMTINVWEAVYFDHDLARLTDLADRAAALGVERYVLDDGWFR
HRRDDHAGLGDWYVDEDVWPDGLRPIIDHVQGLGMEFGIWFEPEMVNEDSDLARAHPEWI
MATGGRLPVRARDQQVLDLAIPAAYDHVLERMTAILTENDIAYIKWDHNRDLVDAGIAPR
GEAGVHLQTLAAYRLMDELKARFPGLEIESCSSGGSRVDLGVLERTDRVWVSDCIDPLDR
QTMMRWTMQLLPPELLGSHIASGVSHTTGRAHRLAFRAGSALYGHLGIEWDLAQATDEEN
ADLAAWIALYKEERALMHSGTVVRADESDPTLLVYGAVAEDAGSALFFLASIGRSEVSPR
GRVLLPGLDPARRYRVEPVRVGTPEPGFVAPAWWGGVELTGRALGASGLHAPLMLPESIA
ILRVTAV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaccgccgtcccctccgccctcctccacctccgggcgtccggcgtctccctg
gtgctcgacctcacggagggccgcctgccggccgtcgtgcactggggcgctggcctcggc
gacaccaccgcggacgacctcgcgacgctggcgctcgccgccgtcgagccgatcgcgggc
agcgtcgccgacgaccccatccgcctcgcgatcctccccgaggcgcacacctcctggacc
ggcaagcccggcctcgagggccaccgcgacggcgccgactggtcgccgctgttccgcgtc
acgtccgcctccgtcgacggcgacccgctccccgctggcgtcgacggccggcccggatcc
gcgtccgccggccccgccctcgtgcacgtcgacgcggtcgacgaggtcgcgggcctcggc
ctcgcgctcgacgtcgagctgctgccgtcgggcctcgtccgcacgcgcgccgaggtcacc
aacacgggcgaggggatctactccgtcggcggcgtcacgctcgcgctgccgctgcccgcc
gaggcccgcgagatcctcgacttcgccggccggtggggcctcgagcgcacgccgcagcgc
cgcgagctcgtggtcgggatccacgagcgcgagggccgcaagggccgcaccggccccgac
gcggcgaccctcctctccgtcggcacgcccggcttcggcttccggtacggcgacgtccgc
ggcgtgcacgtcgccttcagcggcaaccaccgccactacgccgagcgcctctccaccggc
cgccaggtgatcggcggcggcgagctgctgctgcccggcgaggtgcgcctggcgcaggga
gaggcgtatgcgagcccgtgggtgtacgccgcgtacggccacggcctcgacgaccaggcc
gcccgcttccaccgccacctgcgcgcgcgggacacgcacccgcgccgcgaccggcccatg
acgatcaacgtgtgggaggccgtctacttcgaccacgacctcgcgcgcctcaccgacctc
gcggatcgcgccgccgccctcggcgtcgagcgctacgtgctcgacgacggctggttccgc
caccgccgcgacgaccacgccggcctcggcgactggtacgtcgacgaggacgtctggccc
gacggcctgcgccccatcatcgaccacgtccagggcctcggcatggagttcggcatctgg
ttcgagcccgagatggtcaacgaggactccgacctggcgcgcgcccacccggagtggatc
atggccaccggcggccgcctccccgtccgcgcccgcgaccagcaggtgctcgacctcgcg
atcccggcggcctacgaccacgtgctcgagcggatgaccgcgatcctgaccgagaacgac
atcgcctacatcaagtgggaccacaaccgcgacctcgtcgacgccggcatcgccccgcgc
ggcgaggcgggcgtgcacctgcagacgctcgccgcgtaccgcctcatggacgagctgaag
gcgcgcttccccggcctcgagatcgagtcgtgctcctcgggcggatcccgcgtcgacctc
ggcgtgctcgagcgcaccgaccgcgtctgggtctccgactgcatcgacccgctcgaccgg
cagacgatgatgcgctggaccatgcagctcctcccgccggagctgctcggctcccacatc
gcgtccggtgtcagccacaccacgggccgcgcgcaccggctcgcgttccgcgcgggctcg
gcgctctacggccacctcggcatcgagtgggacctcgcgcaggcgaccgacgaagagaac
gcggacctcgcggcgtggatcgccctctacaaggaggagcgcgcgctcatgcactcgggc
acggtggtccgcgcggacgagagcgacccgacgctgctcgtctacggcgccgtcgcggag
gacgcgggctccgcgctgttcttcctcgcgtcgatcggccgctccgaggtctcgccgcgc
ggccgcgtcctgctgccgggcctggatcccgcgcgccgctaccgcgtggagcccgtgcgc
gtcggcacccccgagccgggcttcgtcgcgccggcctggtggggcggcgtcgagctgacg
ggccgcgcgctcggggcctcgggcctgcacgcgccgctgatgctgcccgagtcgatcgcg
atcctgcgggtgacggcggtctga

DBGET integrated database retrieval system