KEGG   Clavibacter nebraskensis: CMN_00546Help
Entry
CMN_00546         CDS       T02530                                 

Gene name
hemY
Definition
(GenBank) Cmm ortholog CMM_0588; Cms ortholog CMS_2848
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cmc  Clavibacter nebraskensis
Pathway
cmc00860  Porphyrin and chlorophyll metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMN_00546 (hemY)
Enzymes [BR:cmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CMN_00546 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CMN_00546 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_2 HI0933_like DAO AlaDh_PNT_C Thi4 Pyr_redox FAD_binding_3 GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CCE74510
UniProt: M5B6P8
Position
533061..534500
Genome map
AA seq 479 aa AA seqDB search
MSSDPRQAAGQVDPTDVVVIGGGVGGLIAARACALAGKRVILVEASPALGGTVGSHVVDG
LRLDSGAESFATRRGTVAAFLGELGLADRIVQPNPDGAWVQLAERAIQLPRTGLLGIPAH
PFDATIATAIGRASVARAKADLLLPASVGAKERTLGGLVRARMGDRVVDRLVAPIVSGVH
SAHPDEVDADSVAPGLRAGLAEQGSLGKAVASMRAASPAGSAVSGIVGGVHLLVDALAAD
LARLGVDVRTSLAVESVHRHRSHEGAAAYDDWHVELADGRGIDAAGVVLAIPAAGLIRLF
SGLAPRAVTEGWPEPSSVELVTLVVRAPELDAAPRGTGVLVAADAPGIRAKALTHATAKW
PWLKEQAGDRHVLRLSYGRAGGDDDTAAVPDDELTAVAVHDASALLGVDLAGRVTGSARV
RWTNALPFAASGHRERVQAVRDEAAEHPGLEITGSAVAGTGLASVVADAQAAAARLLGR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagcgacccgcggcaggcggccggccaggtggatcccacggacgtcgtggtgatc
ggcggcggcgtgggcggcctcatcgccgcccgcgcgtgcgccctcgccgggaagcgcgtg
atcctcgtggaggcgtcgcccgcgctcggcggcaccgtcggatcccacgtggtcgacggc
ctccgcctcgacagcggcgccgagagcttcgccacccgccgcggcacggtcgccgccttc
ctcggggagctcggcctcgccgaccggatcgtgcagccgaatccggacggcgcgtgggtg
cagctcgccgagcgcgccatccagctgccgcgcacgggcctgctcgggatccccgcgcac
ccgttcgacgccaccatcgccaccgccatcggccgggccagcgtcgcccgcgcgaaggcc
gacctcctcctccccgcctccgtcggcgcgaaggagcgcacgctcggcggcctcgtccgc
gcccgcatgggcgaccgcgtggtcgaccggctggtcgcccccatcgtctctggcgtgcac
agcgcccaccccgacgaggtcgacgccgactccgtcgcgcccggcctccgcgccggcctc
gccgagcaggggtcgctcgggaaggcggtcgcgtccatgcgcgcggcgtcccccgcggga
tccgccgtcagcggcatcgtcggcggcgtgcacctgctcgtcgacgccctggccgccgac
ctcgcgcgcctcggcgtcgacgtccgcacctcgctcgccgtggagtccgtgcaccggcac
cgctcgcacgagggcgcggccgcgtacgacgactggcacgtcgagctcgccgacggccgc
ggcatcgacgcggcgggcgtggtcctcgcgatccccgctgccgggctcatccgcctcttc
tccggcctcgcgccccgcgccgtcacggagggctggcccgagccgtcctccgtcgagctg
gtcacgctcgtcgtgcgcgcgcccgagctcgacgccgcaccccgcggcacgggcgtgctc
gtcgcggccgacgccccggggatccgcgccaaggccctcacgcacgccaccgccaagtgg
ccgtggctgaaggagcaggcgggcgaccggcacgtgctccgcctctcctacgggcgcgcg
ggcggcgatgacgacaccgcggccgtccccgacgacgagctcaccgccgtcgcggtgcac
gacgcgtcggcgctgctcggcgtcgacctggccggccgcgtcaccggatccgcccgcgtg
cgctggaccaacgccctcccgttcgccgcctccggccaccgcgagcgcgtgcaggccgtg
cgcgacgaggccgcggagcacccgggcctcgagatcaccggatccgccgtcgcgggcacc
ggtctcgcctccgtggtggccgacgcgcaggccgcggcggcacgcctcctgggccgctga

DBGET integrated database retrieval system