KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00546Help
Entry
CMN_00546         CDS       T02530                                 

Gene name
hemY
Definition
hypothetical protein (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMN_00546 (hemY)
Enzymes [BR:cmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CMN_00546 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
533061..534500
Genome map
AA seq 479 aa AA seqDB search
MSSDPRQAAGQVDPTDVVVIGGGVGGLIAARACALAGKRVILVEASPALGGTVGSHVVDG
LRLDSGAESFATRRGTVAAFLGELGLADRIVQPNPDGAWVQLAERAIQLPRTGLLGIPAH
PFDATIATAIGRASVARAKADLLLPASVGAKERTLGGLVRARMGDRVVDRLVAPIVSGVH
SAHPDEVDADSVAPGLRAGLAEQGSLGKAVASMRAASPAGSAVSGIVGGVHLLVDALAAD
LARLGVDVRTSLAVESVHRHRSHEGAAAYDDWHVELADGRGIDAAGVVLAIPAAGLIRLF
SGLAPRAVTEGWPEPSSVELVTLVVRAPELDAAPRGTGVLVAADAPGIRAKALTHATAKW
PWLKEQAGDRHVLRLSYGRAGGDDDTAAVPDDELTAVAVHDASALLGVDLAGRVTGSARV
RWTNALPFAASGHRERVQAVRDEAAEHPGLEITGSAVAGTGLASVVADAQAAAARLLGR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgagtagcgacccgcggcaggcggccggccaggtggatcccacggacgtcgtggtgatc
ggcggcggcgtgggcggcctcatcgccgcccgcgcgtgcgccctcgccgggaagcgcgtg
atcctcgtggaggcgtcgcccgcgctcggcggcaccgtcggatcccacgtggtcgacggc
ctccgcctcgacagcggcgccgagagcttcgccacccgccgcggcacggtcgccgccttc
ctcggggagctcggcctcgccgaccggatcgtgcagccgaatccggacggcgcgtgggtg
cagctcgccgagcgcgccatccagctgccgcgcacgggcctgctcgggatccccgcgcac
ccgttcgacgccaccatcgccaccgccatcggccgggccagcgtcgcccgcgcgaaggcc
gacctcctcctccccgcctccgtcggcgcgaaggagcgcacgctcggcggcctcgtccgc
gcccgcatgggcgaccgcgtggtcgaccggctggtcgcccccatcgtctctggcgtgcac
agcgcccaccccgacgaggtcgacgccgactccgtcgcgcccggcctccgcgccggcctc
gccgagcaggggtcgctcgggaaggcggtcgcgtccatgcgcgcggcgtcccccgcggga
tccgccgtcagcggcatcgtcggcggcgtgcacctgctcgtcgacgccctggccgccgac
ctcgcgcgcctcggcgtcgacgtccgcacctcgctcgccgtggagtccgtgcaccggcac
cgctcgcacgagggcgcggccgcgtacgacgactggcacgtcgagctcgccgacggccgc
ggcatcgacgcggcgggcgtggtcctcgcgatccccgctgccgggctcatccgcctcttc
tccggcctcgcgccccgcgccgtcacggagggctggcccgagccgtcctccgtcgagctg
gtcacgctcgtcgtgcgcgcgcccgagctcgacgccgcaccccgcggcacgggcgtgctc
gtcgcggccgacgccccggggatccgcgccaaggccctcacgcacgccaccgccaagtgg
ccgtggctgaaggagcaggcgggcgaccggcacgtgctccgcctctcctacgggcgcgcg
ggcggcgatgacgacaccgcggccgtccccgacgacgagctcaccgccgtcgcggtgcac
gacgcgtcggcgctgctcggcgtcgacctggccggccgcgtcaccggatccgcccgcgtg
cgctggaccaacgccctcccgttcgccgcctccggccaccgcgagcgcgtgcaggccgtg
cgcgacgaggccgcggagcacccgggcctcgagatcaccggatccgccgtcgcgggcacc
ggtctcgcctccgtggtggccgacgcgcaggccgcggcggcacgcctcctgggccgctga

DBGET integrated database retrieval system