KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00555Help
Entry
CMN_00555         CDS       T02530                                 

Gene name
hemD
Definition
(GenBank) Cmm ortholog CMM_0597; Cms ortholog CMS_2840
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00860  Porphyrin and chlorophyll metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
cmc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CMN_00555 (hemD)
Enzymes [BR:cmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CMN_00555 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CCE74519
UniProt: M5B8B4
Position
541062..541901
Genome map
AA seq 279 aa AA seqDB search
MTSTDQKPLKGWRVLVPRGGPWGDGVAYDLRAQGATPVVAPMINFAATQDAQALESALAD
LAAGSFDWLTVTSATTVDVLSSHRAVVPEGTRIAAVGETTAAALVAAGYTVDFVPSIDSS
AMALLDEWTEMAAGSPRRRVLTLRSEIAKPTLTDGLIARGHDVRSVVAYRTVGVPVSDRI
REDVSSGRVRAILVTSGSVAEQVHEQLGDVPDGVLIACIGPRTAKDARRSGVRVDVVASE
RSAASLIQSLVEIARHEEPRADTAGLTGLADLLDRSTTE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacagaccagaagcccctgaagggctggcgcgtcctcgtgccccgcggcgga
ccgtggggcgacggcgtcgcgtacgacctccgcgcgcagggcgccacgcccgtcgtcgcg
cccatgatcaacttcgccgccacgcaggacgcgcaggcgctcgagtcggccctcgccgac
ctcgccgcgggatccttcgactggctcaccgtcacgagcgccaccacggtcgacgtgctg
tcgtcgcaccgcgccgtcgtgcccgagggcacgcgcatcgcggccgtcggcgagaccacg
gccgccgcgctcgtcgccgcgggctacacggtcgacttcgtgccgtccatcgactcgtcc
gccatggcgctcctcgacgagtggaccgagatggccgcgggatcccctcgccgccgcgtg
ctcacgctccgctccgagatcgcgaagccgacgctcaccgacgggctcatcgcgcgcggc
cacgacgtccgctcggtcgtcgcgtaccgcaccgtcggcgtccccgtcagcgaccggatc
cgcgaggacgtgtcctccggccgcgtccgcgcgatcctcgtcacctcgggcagcgtcgcg
gagcaggtgcacgagcagctgggcgacgtccccgacggcgtcctcatcgcctgcatcggc
ccacgcaccgcgaaggacgcgcgccgatccggcgtgcgcgtcgacgtggtcgcctccgag
cgctcggccgcgtcgctcatccagtcgctggtcgagatcgcccgccacgaggagccgcgt
gccgacacggcggggctcaccggcctcgccgacctcctcgatcggagcaccaccgaatga

DBGET integrated database retrieval system