KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00844Help
Entry
CMN_00844         CDS       T02530                                 

Gene name
xylA
Definition
hypothetical protein (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cmc00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cmc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(849547..850740)
Genome map
AA seq 397 aa AA seqDB search
MALTPTREDKFSFGLWTIGYTGADPFGGPTRSDLDVVEGVERISELGAYGLTFHDDDLFA
FGSTDAERQTQIDRLKGALSDTGIVVPMVTTNLFSAPVFKDGGFTSNDRAVRRFAIHKVL
RNIDLAAELGAQTFVMWGGREGAEYDSAKDVRGALERYREAVNLLGDYVTDKGYDIRFAI
EPKPNEPRGDILLPTLGHALAFIETLERPELVGVNPEVGHEQMAGLNFTAGIMQALYQGK
LFHIDLNGQRGIKYDQDLVFGHGDLQNAFSLVDLLENGGVGGGRSYDGPRHFDYKPSRTE
DITGVWDSAAANMRMYLLLKERAQAFRADPEVQEALAAAKVQDIYTPTLDEGESYDDILA
DRSSYEDFAADEYFDAKGFGFVRLNQLALEHLMGARS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacccccacccgcgaggacaagttctcgttcggactctggaccatcggatac
acgggggccgatcccttcggcggccccacccgctccgacctcgacgtggtcgagggcgtc
gagcgcatctcggagctgggcgcctacggcctcaccttccacgacgacgacctcttcgcg
ttcggatccaccgacgccgagcgccagacgcagatcgaccgcctcaagggcgcgctcagc
gacaccggcatcgtcgtgccgatggtcaccaccaacctcttctcggctcccgtcttcaag
gacggcggcttcaccagcaacgaccgcgccgtccgccggttcgcgatccacaaggtgctg
cgcaacatcgacctcgccgccgagctcggcgcgcagacgttcgtgatgtggggcggccgc
gagggcgccgagtacgactccgccaaggacgtccgcggcgcgctcgagcgctaccgcgag
gccgtcaacctcctcggcgactacgtcaccgacaagggctacgacatccgcttcgcgatc
gagccgaagcccaacgagccccgcggcgacatcctgctgccgaccctcggccacgcgctc
gccttcatcgagaccctcgagcggcctgagctcgtcggcgtgaaccccgaggtcggccac
gagcagatggcgggcctcaacttcaccgccggcatcatgcaggcgctgtaccagggcaag
ctcttccacatcgacctcaacggccagcgcggcatcaagtacgaccaggacctcgtcttc
ggccacggcgacctgcagaacgcgttctcgctcgtcgacctgctggagaacggcggcgtg
ggcggcggccgctcgtacgacggcccccgtcacttcgactacaagcccagccgcaccgag
gacatcacgggcgtgtgggactccgcggccgcaaacatgcgcatgtacctgctcctcaag
gagcgcgcgcaggcgttccgcgccgaccccgaggtgcaggaggcgctcgccgccgccaag
gtccaggacatctacacgccgaccctcgacgagggcgagtcctacgacgacatcctggcc
gaccgctcctcctacgaggacttcgccgccgacgagtacttcgacgccaagggcttcggc
ttcgtccgcctcaaccagctggcgctcgagcacctgatgggcgcgcgctcctag

DBGET integrated database retrieval system