KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00904Help
Entry
CMN_00904         CDS       T02530                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CMN_00904
Enzymes [BR:cmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CMN_00904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
924803..925633
Genome map
AA seq 276 aa AA seqDB search
MPMGRVVVLGSLNVDQVVRVPRHPQPGETLMGSDPERLWGGKGANQAVAAADAGGEVAMV
GAVGDDADGSAYRARLADRGIDVSGLATIAGATTGLAIIAVDDDGENTIIVAPGANARVT
DAHLDPLDALAAGDVLLASLELPLDTVAAGVRRAHAAGARVVLNLAPFAALPDDVLALAD
PVVVNEHEAGLLRGSGTPAPASLLVTLGAEGAMWGGVEVPASRVSRVVDTTGAGDAFCGA
LASALAAGADREGALVVAADAAAVVVQRQGAQPADD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatgggccgcgtcgtcgtgctcggatcgctcaacgtcgaccaggtggtgcgcgtg
ccgcggcacccgcagccgggggagaccctgatgggatccgaccccgagcggctctggggc
ggcaagggcgcgaaccaggcggtcgccgcggccgacgccggcggcgaggtcgcgatggtc
ggggccgtgggcgacgacgccgacggatccgcctaccgcgcccgcctcgccgaccgcggc
atcgacgtgtccggcctcgcgacgatcgcgggcgccacgacgggcctcgcgatcatcgcg
gtcgacgacgacggcgagaacacgatcatcgtcgcgcccggcgcgaacgcccgcgtgacc
gacgcccacctggatccgctcgacgcgctcgcggcgggcgatgtcctgctcgcctcgctc
gagctgcccctcgacacggtcgccgcgggcgtccgccgcgcgcacgccgccggcgcccgc
gtcgtgctcaacctggcgcccttcgccgcgctgcccgacgacgtgctggcgctcgcggat
cccgtcgtcgtcaacgagcacgaggcgggcctcctccgcgggtcgggcacgcccgcgccc
gcgtcgctgctcgtgaccctcggcgccgagggcgcgatgtggggcggcgtcgaggtgccc
gcgtcgcgggtctcccgcgtcgtcgacaccacgggcgcgggcgacgccttctgcggcgcg
ctggcctccgcgctcgccgcgggcgccgaccgcgagggcgccctcgtcgtcgcggccgac
gccgcggcggtcgtcgtccagcggcagggcgcgcagccggcggacgactga

DBGET integrated database retrieval system