KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_01104Help
Entry
CMN_01104         CDS       T02530                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cmc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cmc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1133120..1133962)
Genome map
AA seq 280 aa AA seqDB search
MPASFVVVPQWQGSGSSRAMRLADGAEAIRGDLPASATHVVDVPVEAGESLGTGVLRYAS
LLAVRTRQEAALEAATASGASPVVTVGGDCGVEIASIGHAAAAHPGLAVVWLDAHADLNS
PASSPSGAFHGMVLRAVIGEGVDGLDLAAGTVTPDRVVLAGVRALDDTESDLVESRGIAL
LGADAVGPEALVAAVAATGAERVYIHVDLDVLDPGAMSGVGYPEPFGLDVQVVTESIKAL
RRSFELAGAGITEFAPSSPAAAVEDMGTILRIIGALTGPV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcctccttcgtcgtcgtcccccaatggcagggctcgggctcgtcccgcgccatg
aggctcgcggacggcgccgaggccatccgcggcgacctgcccgcgtccgccacgcacgtc
gtcgacgtgcccgtcgaggcgggcgagtcgctcggcaccggcgtgctccgctacgcgtcg
ctgctcgcggtgcgcacccgccaggaggcggcgctcgaggcggcgacggcgtccggcgcg
tcccccgtcgtcaccgtcggcggcgactgcggcgtggagatcgcgtccatcgggcacgcg
gccgccgcgcatcccggcctcgcggtcgtgtggctcgacgcccacgccgacctcaactcc
cccgcctcctccccgagcggcgccttccacggcatggtgctgcgcgccgtcatcggcgag
ggcgtcgacgggctggatctcgccgcgggcaccgtcacgcccgaccgcgtcgtgctcgcc
ggcgtgcgcgcgctggacgacaccgagtccgacctcgtcgagtcgcgcgggatcgcgctc
ctcggcgccgacgccgtggggcccgaggcgctcgtcgccgcggtggccgcgaccggcgcc
gagcgcgtctacatccacgtcgacctcgacgtgctcgaccccggtgccatgtccggcgtg
ggataccccgagccgttcgggctcgacgtgcaggtcgtgaccgagtcgatcaaggcgctg
cgccggtcgttcgagctcgcgggcgcggggatcaccgagttcgcgccctcctcccccgcg
gcggccgtggaggacatgggcaccatcctgcggatcatcggggcgctgaccgggcccgtg
tga

DBGET integrated database retrieval system