KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_01331Help
Entry
CMN_01331         CDS       T02530                                 

Gene name
fpgA
Definition
hypothetical protein (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CMN_01331 (fpgA)
Enzymes [BR:cmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CMN_01331 (fpgA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CMN_01331 (fpgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375085..1376020
Genome map
AA seq 311 aa AA seqDB search
MPELPEVEVVRAGLEPAVSGARITGVEILDARSLKRHDPIEGAFVDLLVGRVITSAVRRG
KFMWLPLEPDAGRDGTGPRALVTHLGMSGQVLLREPGSDPEGLLRIRMGIEHPVHGELVV
AFVDQRIFGSMAVDRLVATPDGHAGGRGSAAALVPTQVAHIARDPLDPAFDDELLLDRLG
RRRTGIKRALLDQTLVSGIGNIYADEALWAARIHYALSTDQLGRGRALRLLAEVRTVLAR
ALAEGGTSFDAQYVNVNGASGYFSHSLNAYGQQGKPCPRCGTPIVREAFMNRGSHLCPHC
QVLPDPDTAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctccccgaggtcgaggtcgtccgcgccggcctcgaaccggccgtcagcgga
gcgcgcatcacgggggtcgagatcctcgacgcgcgctccctcaagcggcacgacccgatc
gagggcgcgttcgtcgacctgctggtcggccgcgtgatcacgtcggccgtccgccgcggc
aagttcatgtggctgccgctcgagcccgacgccggacgcgacgggacgggaccgcgcgcg
ctcgtcacccacctcggcatgagcgggcaggtgctcctccgcgagcccggctccgacccg
gagggcctgctgcggatccgcatgggcatcgagcatcccgtccacggcgagctcgtggtc
gccttcgtcgaccagcggatcttcggctcgatggccgtcgaccgcctcgtcgccactcca
gacgggcacgcgggcggacgcggatccgccgccgccctcgtgccgacgcaggtcgcccac
atcgcgcgggaccccctcgacccggcgttcgacgacgaactgctgctcgaccggctcggg
cgccgccgaacggggatcaagcgcgcgctgctcgaccagacgctcgtgagcggcatcggc
aacatctacgcggacgaggcgctgtgggccgcgcggatccactacgcgctgtcgacggac
cagctcggccgggggcgcgccctgcggctgctcgccgaggtgcggaccgtgctggcccgg
gcattggccgagggcgggacgagcttcgacgcgcagtacgtcaacgtcaacggcgcgtcc
ggctacttctcgcactcgctgaacgcctacgggcagcagggcaagccctgcccgcgctgc
ggcacgcccatcgtgcgcgaggccttcatgaaccgcggctcgcacctgtgcccgcactgc
caagtgctgccggatccggacacggcggccgcctga

DBGET integrated database retrieval system