KEGG   Clavibacter nebraskensis: CMN_01826Help
Entry
CMN_01826         CDS       T02530                                 

Gene name
hisD
Definition
(GenBank) Cmm ortholog CMM_1848; Cms ortholog CMS_1384
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cmc  Clavibacter nebraskensis
Pathway
cmc00340  Histidine metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
cmc01230  Biosynthesis of amino acids
Module
cmc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CMN_01826 (hisD)
Enzymes [BR:cmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CMN_01826 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CCE75771
UniProt: M5B9I6
Position
complement(1917467..1918771)
Genome map
AA seq 434 aa AA seqDB search
MRIQDLRGTTPSTADLLALLPRPVTDVAVALDVARELVEDVRTRGSAALLDQAERLDRVR
PETLRVPSAAIAAAVDGLDPAVRAALEEAIRRVRLGSAAQVPPETTTTVVPGGTIVQRWQ
PVRRVGLYVPGGKAVYPSSVVMNVVAAQVAGVASIALASPAQAAHGGSVHPVILGAAGLL
GVDEVYAMGGAGAIGAFAHGVPDLGLEPVDVVTGPGNIYVAAAKRVVRGVTGIDSEAGTT
EILVIADAHADARLVAADLVSQAEHDEMAASVLVTDSPELARAVDAEVEALAASTGHAAR
VGQALTGPQSAILVVDDLATAARYSDAYGPEHLSVQTADPDALLAHLQSAGAIFLGPHSP
VSLGDYLAGSNHVLPTGGQARFGSGLGAYTFLRPQQVVRYDADALREAEPMIVALSRAED
LPAHGDAVTARLTR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatccaggacctccgcggcaccacgcccagcaccgccgatctgctcgccctcctc
ccgcgtcccgtcaccgacgtcgccgtcgcgctcgacgtggcccgcgagctcgtcgaggat
gtgcgcacccgggggagcgcggccctgctcgaccaggcggagcggctcgaccgcgtgcga
ccggagacgctgcgcgtgccctccgcggccatcgccgccgccgtcgacgggctcgacccc
gccgtccgcgcggcgctcgaggaggccatccgccgcgtgcgcctcggctcggcggcgcag
gtcccgccggagaccacgaccacggtcgtgcccggcggcaccatcgtccagcgctggcag
cccgtgcgccgcgtcggcctctacgtgcccggcggcaaggccgtctacccgtcgagcgtc
gtgatgaacgtcgtcgccgcgcaggtcgccggcgtcgcgagcatcgcgctcgcctctccc
gcgcaggccgcgcacgggggatcggtgcacccggtcatcctcggcgctgccggcctcctc
ggcgtcgacgaggtctacgcgatgggcggcgccggcgccatcggcgccttcgcgcacggc
gtgccggatctcggcctggagcccgtcgacgtcgtcacgggacccggcaacatctacgtc
gcggcggccaagcgcgtcgtccgcggcgtcacggggatcgactccgaggccggcacgacg
gagatcctcgtcatcgccgacgcgcacgccgacgcccgcctcgtcgccgccgacctcgtc
agccaggcggagcacgacgagatggcggcatccgtcctcgtcaccgactcgccggagctc
gctcgcgcggtcgacgccgaggtcgaggccctggccgcgtccaccggccacgcggcccgc
gtcggccaggcgctcaccggcccgcagtcggccatcctcgtcgtcgacgacctcgcgacg
gccgcccgctacagcgacgcctacggccccgagcacctgtccgtgcagaccgccgacccc
gacgcgctcctcgcgcacctgcagagcgccggcgcgatcttcctcggcccgcactcgccg
gtgagcctcggcgactacctcgcggggtccaaccacgtcctccccacgggcggccaggcg
cggttcggctcgggcctcggcgcgtacacgttcctccggccgcagcaggtggtgcgctac
gacgccgacgcgctgcgcgaggccgagccgatgatcgtcgcgctcagccgggccgaggac
ctccccgcgcacggcgacgcggtgaccgcgcgcctcacgcgctga

DBGET integrated database retrieval system