KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02390Help
Entry
CMN_02390         CDS       T02530                                 

Gene name
cel
Definition
secreted cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMN_02390 (cel)
Enzymes [BR:cmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CMN_02390 (cel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2525339..2526973)
Genome map
AA seq 544 aa AA seqDB search
MNIRRPLTSLMLGLLLPVAIATAGASAGAASAADQGSSASTTASGWLHTDGGKIVNSAGA
TYTIRGANWFGLESSGCVLHGLDKITLDSGMKHLHDLGFTTVRLPYANECLRTASVADWG
TSANPDLKGVSPLTMMDRAIASAKANGLNVFLDQHRPDTNGQTELWYSGSLPESQWISDW
KMLANRYKDDPTVIGVDLHNEPHGSATWGDGNTATDWRLAAERGGNAVLSVNPKLLVIVE
GTDRDSKSGTWWGGGLGDAGDKPVALSVPNRVVYSPHDYPSTIYGQSWFNAPDYPNNLPG
VWDAHWGYLAKKNTAPVLLGEFGTQLQTTSDKQWLSTLVNYLKTTGISSAYWSFNPDSNN
TGGLLKSDWVTPEQAKLDALAPILHPQNPSSSSQPQPEPQPEPQPQPQPQPEPQPEPQPQ
PQPQPQPQPQPEPQPQPQPQPEPQPSGSATATYKLDGSWPTGYTSELVITAKSAVSSWTV
SWDSPGITAVTNSWGMKCTVASSRITCTGDGWAAKIPAGQTMHVGLNVAGTQAPSNPVLT
FTSN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacgaagacccctcacctccctcatgctcggactgctcctccccgtcgcgatc
gcgacggcgggagcatcggcaggcgcggcctccgcagcagatcagggaagctccgcgtcc
acgaccgcctcggggtggctccacaccgatggcggcaagatcgtcaactccgccggtgcc
acgtacaccatccgcggtgccaactggttcggtctggagtcgtccggctgcgtgctccac
gggctcgacaagatcactctcgacagtggcatgaagcacctgcacgacttgggcttcacg
acggtgcgccttccgtacgcgaacgagtgcctccggaccgccagcgtggcggactggggg
acctccgccaatccggatctcaagggcgtgtccccgctgacgatgatggaccgcgccatc
gcgtcggcgaaggccaacggcctgaacgtgttcctcgaccagcaccgtccggacaccaac
ggccagaccgagctctggtactccggtagccttcccgaatcgcagtggatctccgactgg
aagatgctcgcgaaccgctacaaggacgaccccacggtcatcggcgtcgacctgcacaac
gagccccacggatccgccacctggggtgatggcaacacggcgacggactggcgcctggcc
gccgagcgcggcggcaacgcggtgctatccgtcaacccgaagctgctggtcatcgtcgag
ggcaccgacagggacagcaagtccggtacctggtggggcggcgggctcggtgacgccggc
gacaagcccgtcgcgctgagcgtgcccaaccgggtcgtctactcgccgcacgactatccg
tcgaccatctacgggcagtcgtggttcaacgcgcccgactaccccaacaacctcccgggt
gtgtgggacgcgcattggggttacctggcgaagaagaacaccgctcccgtcctgctcggt
gagttcggcacccagctccagaccacgagcgacaagcagtggctgtccactctggtgaac
tacctcaagaccaccggcatcagctcggcctactggtcgttcaacccggacagcaacaac
accggcggactgctgaagtccgactgggtgaccccggagcaggccaagctcgacgcgctg
gcgccgatcctccacccgcagaacccgtcgtcctcgtcgcagcctcagccggagccgcag
ccggagccgcagccgcagccgcagccgcagccggagccgcagccggagccgcagccgcag
cctcagccgcagccgcagccgcagccgcagccggagccgcagccgcagccgcagccgcag
ccggagccgcagccgtcgggctcagcgaccgccacctacaagctggacggatcgtggccc
acgggctacacgtctgagctcgtcatcactgcgaagtccgcggtgtcgagttggacggtc
tcctgggacagccccggaatcacggctgtcacgaacagctggggcatgaagtgcaccgtg
gcgtcgagccgcatcacgtgcaccggtgatggctgggccgccaagatcccggccggacag
accatgcacgtcggtctgaacgtcgcgggaactcaggctccgagcaaccccgtgctcaca
ttcaccagtaactga

DBGET integrated database retrieval system