KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02390Help
Entry
CMN_02390         CDS       T02530                                 

Gene name
cel
Definition
secreted cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2525339..2526973)
Genome map
AA seq 544 aa AA seqDB search
MNIRRPLTSLMLGLLLPVAIATAGASAGAASAADQGSSASTTASGWLHTDGGKIVNSAGA
TYTIRGANWFGLESSGCVLHGLDKITLDSGMKHLHDLGFTTVRLPYANECLRTASVADWG
TSANPDLKGVSPLTMMDRAIASAKANGLNVFLDQHRPDTNGQTELWYSGSLPESQWISDW
KMLANRYKDDPTVIGVDLHNEPHGSATWGDGNTATDWRLAAERGGNAVLSVNPKLLVIVE
GTDRDSKSGTWWGGGLGDAGDKPVALSVPNRVVYSPHDYPSTIYGQSWFNAPDYPNNLPG
VWDAHWGYLAKKNTAPVLLGEFGTQLQTTSDKQWLSTLVNYLKTTGISSAYWSFNPDSNN
TGGLLKSDWVTPEQAKLDALAPILHPQNPSSSSQPQPEPQPEPQPQPQPQPEPQPEPQPQ
PQPQPQPQPQPEPQPQPQPQPEPQPSGSATATYKLDGSWPTGYTSELVITAKSAVSSWTV
SWDSPGITAVTNSWGMKCTVASSRITCTGDGWAAKIPAGQTMHVGLNVAGTQAPSNPVLT
FTSN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacgaagacccctcacctccctcatgctcggactgctcctccccgtcgcgatc
gcgacggcgggagcatcggcaggcgcggcctccgcagcagatcagggaagctccgcgtcc
acgaccgcctcggggtggctccacaccgatggcggcaagatcgtcaactccgccggtgcc
acgtacaccatccgcggtgccaactggttcggtctggagtcgtccggctgcgtgctccac
gggctcgacaagatcactctcgacagtggcatgaagcacctgcacgacttgggcttcacg
acggtgcgccttccgtacgcgaacgagtgcctccggaccgccagcgtggcggactggggg
acctccgccaatccggatctcaagggcgtgtccccgctgacgatgatggaccgcgccatc
gcgtcggcgaaggccaacggcctgaacgtgttcctcgaccagcaccgtccggacaccaac
ggccagaccgagctctggtactccggtagccttcccgaatcgcagtggatctccgactgg
aagatgctcgcgaaccgctacaaggacgaccccacggtcatcggcgtcgacctgcacaac
gagccccacggatccgccacctggggtgatggcaacacggcgacggactggcgcctggcc
gccgagcgcggcggcaacgcggtgctatccgtcaacccgaagctgctggtcatcgtcgag
ggcaccgacagggacagcaagtccggtacctggtggggcggcgggctcggtgacgccggc
gacaagcccgtcgcgctgagcgtgcccaaccgggtcgtctactcgccgcacgactatccg
tcgaccatctacgggcagtcgtggttcaacgcgcccgactaccccaacaacctcccgggt
gtgtgggacgcgcattggggttacctggcgaagaagaacaccgctcccgtcctgctcggt
gagttcggcacccagctccagaccacgagcgacaagcagtggctgtccactctggtgaac
tacctcaagaccaccggcatcagctcggcctactggtcgttcaacccggacagcaacaac
accggcggactgctgaagtccgactgggtgaccccggagcaggccaagctcgacgcgctg
gcgccgatcctccacccgcagaacccgtcgtcctcgtcgcagcctcagccggagccgcag
ccggagccgcagccgcagccgcagccgcagccggagccgcagccggagccgcagccgcag
cctcagccgcagccgcagccgcagccgcagccggagccgcagccgcagccgcagccgcag
ccggagccgcagccgtcgggctcagcgaccgccacctacaagctggacggatcgtggccc
acgggctacacgtctgagctcgtcatcactgcgaagtccgcggtgtcgagttggacggtc
tcctgggacagccccggaatcacggctgtcacgaacagctggggcatgaagtgcaccgtg
gcgtcgagccgcatcacgtgcaccggtgatggctgggccgccaagatcccggccggacag
accatgcacgtcggtctgaacgtcgcgggaactcaggctccgagcaaccccgtgctcaca
ttcaccagtaactga

DBGET integrated database retrieval system