KEGG   Corynebacterium maris: B841_01475Help
Entry
B841_01475        CDS       T02784                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
cmd  Corynebacterium maris
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B841_01475
  Amino acid metabolism
   00380 Tryptophan metabolism
    B841_01475
Enzymes [BR:cmd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     B841_01475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
308061..309638
Genome map
AA seq 525 aa AA seqDB search
MANIDDILSQGRRNPAHKHTTRHNGAPIPSENHSITQGKQGSVILDDIHLVEKLAHFNRE
MVPDRIPHAKGHGAFGELHVTEDVSQYTKAKLFQPGAVTPMGIRFSTVAGESGSPDTWRD
VHGFAMRYYTQDGNYDIVGNNTPIFFVRDAMKFPDFIHSQKRLEANGLRSADMQWDFWTR
APESAHQVTYLMGGRGTPKTNRHMNGYGSHTFQWINAAGEAFWIKYHFVSQQGVENFTDA
EATEMAGINADYHREDLWEAIERGDFPKWDVYVQVMPVDEAEDYRFNPFDLTKIWSKKDY
PRIKVGYFELNRNPENYHNQIEQIALDPSNLVPGVGFSPDKMLQGRIFAYADQQRYRIGP
NYRQLPVNRPVNGDVNTYSHKGQMAYEHNDPDAPVYSPNGRGKGAGYLDDGVTSNHGDYF
SDANDYGEADDAMVGLNTHGDELYRGTYVKHAEDDDFIQPGTLYREVMDDKEKEELADNI
TGAMVGVSPDVEERCYWYWSSVDENLGKRVKELFAAKKDLPEDHK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatcgacgacattctgtcgcagggtcgccgcaaccccgcgcacaagcacacc
acccgccacaacggcgccccgatcccgtccgagaaccactcgatcacccagggcaagcag
ggttcggtcattctcgatgacatccacctcgtggagaagctggcccacttcaaccgcgag
atggtcccggaccgcatcccgcacgccaagggccacggcgccttcggtgagctgcacgtg
accgaggacgtctcccagtacaccaaggccaagctgttccagccgggcgccgtcaccccg
atgggcatccgcttttccacggtcgccggcgagtccggctccccggacacctggcgtgac
gtgcacggcttcgccatgcgctactacacccaggacggcaactacgacatcgtgggcaac
aacaccccgatcttcttcgtccgcgacgccatgaagttcccggacttcatccactcgcag
aagcgcctggaggccaacggcctgcgctccgccgacatgcagtgggacttctggacccgc
gcaccggaatccgcgcaccaggtcacctacctgatgggcggccgcggcaccccgaagacc
aaccgccacatgaacggctacggctcccacaccttccagtggatcaacgccgccggcgag
gccttctggatcaagtaccacttcgtctcccagcagggcgtcgagaacttcaccgacgcc
gaggccaccgagatggccggcatcaacgccgactaccaccgtgaggacctgtgggaggcc
atcgagcgcggcgacttcccgaagtgggacgtctacgtgcaggtcatgccggtcgacgag
gcggaggactaccgcttcaaccccttcgacctgaccaagatctggtccaagaaggactac
ccgcgcatcaaggtcggttacttcgagctcaaccgcaacccggagaactaccacaatcag
atcgagcagatcgccctggacccgtccaacctggttccgggcgtgggcttctccccggac
aagatgctgcagggccgcatcttcgcctacgcggatcagcagcgttaccgcatcgggccg
aactaccgtcagctgccggtcaaccgcccggtcaacggcgacgtcaacacctactcccac
aaggggcagatggcgtacgagcacaacgaccccgacgctccggtctacagcccgaacggc
cgcggcaagggcgccggctacctggatgacggcgtgacctccaaccacggcgactacttc
agcgacgccaacgactacggtgaggcggacgacgccatggtgggcctgaacacccacggc
gacgagctctaccgcggcacctacgtcaagcacgccgaggacgacgacttcatccagccg
ggcaccctgtaccgtgaggtcatggatgacaaggagaaggaggagctggcggacaacatc
accggcgccatggtcggcgtctccccggacgtcgaggagcgctgctactggtactggtcc
tccgtggacgagaacctgggcaagcgcgtcaaggaactcttcgccgccaagaaggatctg
ccggaagatcacaagtaa

DBGET integrated database retrieval system