KEGG   Corynebacterium maris: B841_01915Help
Entry
B841_01915        CDS       T02784                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cmd  Corynebacterium maris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B841_01915
Enzymes [BR:cmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B841_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397532..398446
Genome map
AA seq 304 aa AA seqDB search
MSATKIVVVGSINADLTTRVPRHPKPGETLLGDGGFFSAGGKGANQAVAAGLLGADVAMI
GAVGTDPQAEAALAPMRRAGVDMQGVAATAETTGLAVITVDDAGENTIVVVPGANADVTH
SYVDEHAELIAGAEILLMQGEIPASGFNRAADLATGRVVVNLAPVVPVGREQLLRADPLL
ANEHEAALVLGQLGAPTDSTDPRTLAHALLEQGFTSVVLTLGADGALVADATGLTDIPTP
RVEAVDTTGCGDAFAGAFVARLAEGARLDDAARYAARVGAFAATGHGAQDSYPSADDALP
EVEG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccaccaagatcgtcgtcgtcggctccatcaacgccgacctgaccacccgggtg
ccccgccaccccaagcccggcgaaacgctcctgggcgacggcggcttcttcagcgccggc
ggcaagggcgccaaccaggccgtcgccgccggtctgctcggcgcggacgtcgccatgatc
ggtgccgtcggcaccgacccccaggccgaggccgcgctggccccgatgcgccgcgccggg
gtcgatatgcagggcgtggccgccacagcagagaccaccggtctggccgtgatcaccgtc
gacgacgccggcgagaacaccatcgtcgtggtccccggcgcgaacgctgacgtcacccac
agctacgtcgacgagcacgccgagctcatcgccggcgcggagatcctgctcatgcagggt
gagatccccgccagcggcttcaaccgcgcggcggacctggcgacgggccgggtggtggtc
aacctggcccccgtcgtgcccgtcggccgcgaacaactgctgcgtgcggatccgttgctg
gccaacgagcacgaggcggcgctggtgctagggcagctcggcgcgcccaccgacagcacg
gacccgcggacgctggcccatgcgctgctggagcagggctttacttctgtggtgctgacg
ctgggggcggacggcgcgttggtcgccgacgccaccgggttgaccgacatccccaccccg
cgggtggaggccgtggacaccaccggctgcggcgacgcgttcgccggggcgttcgtggcc
cgcctcgccgagggcgcgaggctggacgacgccgcccgttacgccgcgcgcgtgggcgcc
ttcgccgccaccggccacggcgcccaggattcgtacccgagcgccgatgacgcgctgccg
gaggtggagggctga

DBGET integrated database retrieval system