KEGG   Corynebacterium maris: B841_02150Help
Entry
B841_02150        CDS       T02784                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cmd  Corynebacterium maris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B841_02150
Enzymes [BR:cmd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     B841_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460384..461781
Genome map
AA seq 465 aa AA seqDB search
MRYAVIGAGLAGLTAATEIRRADADATIHVFEATDRIGGKLFTVPFASGPTDLGAEAFLA
RRQDAVDYFTELGLGESIVHPSGLRSLVYTEGQAKNLPAGGVMGIPSSSAPVVHLVSEDT
ARRIDAEGDAEAIDWAIGGDVNIGALVRERYGDEVVDRVISALLGGVYSCTADDLGMRAT
VPQLAEAFDALAEAGEKTTLSAAVRRIEDARPAPGAGEKPAPVFGTFRGGYAEAYEALAE
ASGAEIYLDAFIAGVERSGDTYTVVGGGEPASEPYDKVVLATPAPTTALLLKKIAPEASE
RLKSVQLANSVVVGLKFDSGAGLPDNSGVLIAADQPGVRAKAFTFSSKKWPHLGERGGAL
VRASFGRFGDDVAVRADEDDLVDWALDDLQEITGFDGREAGLAEIYTQRWFGGLPRYDET
HLDTVAAVRGHLDGVAGLEVTGAWAGGVGVPAVIADARAAVGRLV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgccgtcatcggcgcaggcctggccggcctgaccgccgccaccgaaatccgc
cgcgccgacgccgacgcgaccatccacgtcttcgaagccaccgaccgcatcggcggcaaa
ctcttcaccgtccccttcgcctccgggccgacggacctcggcgcggaagccttcctcgcg
cgccggcaagacgccgtcgactacttcaccgaactgggcctgggcgagtccatcgtccac
ccctcggggctgcgctcgctggtctacacggaaggacaggccaagaacctgcccgccggg
ggagtgatgggcatcccgtcctcctccgcccccgtggtgcacctggtcagcgaagacacc
gcccgccgcatcgacgccgaaggcgacgccgaggccatcgactgggcgatcggcggggac
gtcaacatcggcgcgctggtgcgcgaacgctacggcgacgaagtcgtcgaccgcgtcatc
tccgccctgctgggcggggtgtactcgtgcaccgccgacgacctcggcatgcgcgccacc
gtcccccagctcgccgaggccttcgacgccctggccgaggcaggggagaagaccaccctc
tccgccgcggtgcgccgcatcgaagacgcccgccccgccccgggggcgggagaaaaaccc
gcccccgtgttcggcaccttccgtggcggttacgccgaagcctacgaagccctggcggag
gcctccggcgcggagatctacctcgacgccttcatcgcgggcgtcgagcgctcgggtgac
acctatacagtcgtcggcggcggggagccggcctccgagccctacgacaaggtggtgctg
gccaccccggcgcccacgacggcgctgctgctgaagaaaatcgcgcccgaggcctccgag
cggttgaagtccgtgcagttggccaactccgtggtcgtgggcctgaagttcgactccggg
gcggggctgccggacaactcgggtgtgctcatcgccgcggaccagccgggggtgcgggca
aaggccttcacgttctcgtcgaagaagtggccgcacctgggggagcggggcggcgccctg
gtgcgtgcctccttcggccggttcggcgacgacgtcgcggtccgcgccgacgaggacgat
ctggtcgactgggcgttggatgatctgcaggagatcaccggtttcgacggccgggaggcc
gggttggctgagatctacacccagcggtggttcggcgggctgccgcgctacgacgagacg
cacttggacaccgtcgcggccgtgcgcggccacctcgacggtgtggcgggtctggaagtc
accggcgcttgggccggcggggtgggggtgcccgcggtgatcgcggacgcccgcgccgcg
gtcgggcgcctggtttag

DBGET integrated database retrieval system