KEGG   Corynebacterium maris: B841_04915Help
Entry
B841_04915        CDS       T02784                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cmd  Corynebacterium maris
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B841_04915
Enzymes [BR:cmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B841_04915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1034414..1034965
Genome map
AA seq 183 aa AA seqDB search
MFAGKTSALLRNITREKRRRRKVLAVTHRLDDRFGVGLIASHDRLSVDAVALGGAEELRE
HFFAASARPDVVALDEAQFFGPGLSPVVAEILRAGTDVDVAGLCQDHGGHPFEPVATLMT
QAEDVIKLVATCAICGAAAVHQQLIDDRPAPPGRSSAERNSTSPAAAPISPGCTARPARS
APH
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggggaaaaccagtgcgctgctgcgtaacatcacccgggagaagcgtcgacgt
cggaaagtcctggccgtcacgcaccgcctcgacgaccgcttcggcgtcgggttgatcgcc
tcccacgaccggctgagcgtcgacgccgtcgcgttgggtggggcggaggagctccgggag
catttcttcgccgcctccgcccgtccggacgtggtcgcgctcgatgaggcgcagttcttc
gggcccgggctctcacccgtcgtcgcagagatcctgcgggcgggcacggacgtggacgtc
gccgggctatgtcaggaccacggcggccaccccttcgaaccggtggccacgctgatgacg
caggcggaagacgtcataaaactcgtcgccacctgcgcgatctgcggcgcggcggcggtc
caccaacagctgatcgacgatcgccccgcccctccgggccgctcgtcggcggagcggaac
tctacgagccccgctgccgcgcccatttccccgggctgtactgctaggccagcccggtca
gctcctcactga

DBGET integrated database retrieval system