KEGG   Corynebacterium maris: B841_05810Help
Entry
B841_05810        CDS       T02784                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cmd  Corynebacterium maris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B841_05810
Enzymes [BR:cmd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     B841_05810
Exosome [BR:cmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B841_05810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237205..1239409)
Genome map
AA seq 734 aa AA seqDB search
MTATSADSTNELLIPEGDLQRLLICQHHAPHDFYGWHPLPSGGSVIRTRQLGAVNVEILI
HNESCPMEHIGDDIWAIRLKDKLAPDYRFAVTYPEAKMDLVADPYHFLPTVTDFDLHLIG
EGRHERLWEALGAHVHSYETSLGEVAGTSFAVWAPSATGVSVIGDFCAWNPNQYPMRTLG
SSGIWEIFIPGLDVGTEYKFAIHDADGNRRDKADPLARATLAPPETVSVVEKSTYEWQDT
EWMAKRDRIDATNRPMSIYEVHLGSWKIGMGYRELREELVDYVVEQGFTHVELMPVAEHP
FGGSWGYQVSGYYAPTARWGSPDDLRALIDAFHARGVGVLVDWVPGHFPKDEWALARFDG
SALYEHPDWRRGEQKDWGTLVFNFGRNEVRNFLVANALYWIEEFHIDGLRVDAVASMIYL
DYSREEGEWEPNQYGGREYLEAVSFLQEMNATVHRAHPGVITVAEESTSWPGVTADTSDN
GLGFSMKWNMGWMNDTLEYFKLDPVHRSYHHNDITFSLVYAFSERYVLPFSHDEVVHGKG
SLWGRMPGDDWNKAAGLRTLYGYMFSHPGKKLLFMGQEFGQTTEWDEAHSVNWGNLEGWG
QDFHQGIQRLVRDANRVYAATPALYEQDNTPMGFQWVKGDAAGENVLAYLRWGADGSAVL
AVINLSGGTHTNFTVGLPRGGDWELLLNTDDSVYEGAGADLPSVVTADDREWDAQPHSLT
LTLPAMSVQWYRAK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacatccgcagacagcacgaatgaactcctcatcccggaaggggacctccag
cgcctgctgatctgccagcaccacgccccgcacgatttctacggctggcatccacttcct
tccggcggctccgtgatccgcacccggcagctgggcgcggtcaacgtcgagatcctcatc
cacaacgagtcctgtcccatggagcacatcggcgacgacatctgggccatccgtctcaag
gacaaactcgccccggattaccgtttcgcggttacctacccggaggcgaagatggatctg
gtcgccgacccctaccacttcctgccgacggtcacggacttcgatctgcacctgatcggg
gaaggccgccacgaacgcctctgggaggccctcggcgcccacgtgcactcctacgaaacc
tccctcggtgaagtcgccggcacctccttcgccgtgtgggccccgtcggccaccggcgtg
tccgtcatcggcgacttctgcgcctggaaccccaaccagtacccgatgcgcaccctcggc
tcctccggcatctgggagatcttcatccccggcctggacgtcggcaccgagtacaagttc
gccatccacgacgcggacggcaaccgccgcgacaaggccgacccgctggcccgtgccacc
ctcgctccgccggagaccgtctccgtggtcgaaaaatccacctacgagtggcaggacacg
gagtggatggccaagcgcgaccgcatcgacgcgaccaaccgcccgatgagcatctacgag
gtccacctcggctcctggaaaatcggcatgggttaccgggagctgcgcgaagagctcgtg
gactacgtcgtcgaacagggcttcacccacgtcgagctcatgcccgtcgccgagcacccc
ttcggcggctcctggggctatcaggtctccggctactacgcccccaccgcccgatggggc
tcccccgacgacctgcgcgcgctcatcgacgcgttccacgcccgcggcgtcggcgtgctc
gtggattgggttccgggccacttccccaaggacgagtgggcgctggcccgcttcgacggc
agcgccctgtacgagcacccggactggcgtcgcggtgagcagaaggactggggcaccctg
gtgttcaacttcggccgcaacgaggtccgcaacttcctcgtggccaacgccttgtactgg
atcgaggagttccacatcgacgggctgcgtgtcgacgccgtcgcctcgatgatctacctc
gactactcccgcgaagaaggcgaatgggagccgaaccagtacggcggccgcgagtacctc
gaggccgtgtccttcctgcaggagatgaacgcgaccgtgcaccgcgcccacccgggcgtg
atcaccgtggccgaagaatccacctcttggccgggcgtcacggcggacacctccgacaac
ggcctcggcttttcgatgaagtggaacatgggctggatgaacgacaccctcgagtacttc
aagctcgacccggtgcaccgctcctaccaccacaacgacatcaccttctccctggtctat
gccttctccgagcgctacgtcttgccgttcagccacgacgaggtcgtccacggcaagggc
tcgctgtggggccggatgccgggcgacgactggaacaaggccgccggcctgcgcacccta
tacggctacatgttctcccacccgggcaaaaagctgctgttcatggggcaggaattcggc
cagaccaccgaatgggacgaggcccactccgtcaactggggcaacctcgaaggctggggg
caggacttccaccagggcatccagcggctggtgcgcgacgccaaccgcgtctacgccgcc
accccggcgctctacgagcaggacaacaccccgatgggcttccagtgggtcaagggcgac
gccgccggcgaaaacgtcctggcctacctccggtggggcgctgacggctccgcggtcctg
gccgtgatcaacctctccggcggcacccacaccaacttcaccgtgggtctgccgcgcggc
ggcgactgggagctgctgctcaacaccgacgactcggtctacgagggggcgggcgccgac
ctaccgtccgtggtcacggccgacgaccgcgagtgggacgcccagccgcactcgctgacg
ctgaccctgccggcgatgagcgtgcagtggtaccgcgccaagtaa

DBGET integrated database retrieval system