KEGG   Corynebacterium maris: B841_06665Help
Entry
B841_06665        CDS       T02784                                 

Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
cmd  Corynebacterium maris
Pathway
cmd00790  Folate biosynthesis
cmd01100  Metabolic pathways
cmd02020  Two-component system
Module
cmd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B841_06665
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B841_06665
Enzymes [BR:cmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B841_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD_N Pur_ac_phosph_N fn3
Motif
Other DBs
NCBI-ProteinID: AGS34806
UniProt: S5TIT3
Position
complement(1440676..1441173)
Genome map
AA seq 165 aa AA seqDB search
MVAGAAVTAIAGAVAAARWAATRPVDGTTARSDYPLGGELPFAHGVASGDPLVDRVIIWT
RHTARGRRPRTVDWEMATDTGFEHVVAAGAQQATRHRDWTVKVDVTGLQPGTTYFYRFSH
RGKASEVGKTRTLPEDPEHLRLAALFVVVVVVLLRLRSPGAAEGH
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgggtgcggcggtgacggcgattgcaggggcggtagccgcggccaggtgggcg
gcgacccgccccgtcgacgggaccaccgcccggtcggactatcccctcggcggcgagctg
cccttcgcgcacggcgtcgccagcggcgacccgttggtcgaccgtgtgatcatctggacc
cggcacaccgcccgtgggcggcgtccccgcaccgtggactgggagatggccaccgacacg
ggcttcgagcacgtggtcgccgccggcgcgcagcaggccacccggcaccgggactggacc
gtcaaagtcgacgtcaccggcctgcagccgggcacgacgtacttctaccgcttctcgcac
cgaggaaaagcttcggaggtgggcaaaacccggaccttgcccgaagacccggagcatctg
cggctggctgcgctgttcgtcgtggtggtcgtcgtacttctccggcttcggtcacctggc
gcagcggaaggacattga

DBGET integrated database retrieval system