KEGG   Corynebacterium maris: B841_09785Help
Entry
B841_09785        CDS       T02784                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cmd  Corynebacterium maris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2123771..2125879
Genome map
AA seq 702 aa AA seqDB search
MTHLDALNELAKAYGLAPSYTDSSGTTVTATADTLVKLLRAMGVDLGEAEEPAESDIQAA
QQTMREELATRPLPLTVAAVEGDAATFDVHVHHGSPAEVAIVCEDGTRREVTQEHNWRQP
VTVAGTTWGEATFRLPADLPTGYHTITLTSGELEASTRLIVSPARLTTADAYLSERRFGV
MAQLYSVRSEASWGIGDFRDLGLLAKTVATEIGADFLLVNPLHAAEPVPPVEDSPYLPTT
RRFTNPIYLHVEDVPEYTQADEKVRAQIDAAAKRFHPRNRSGEVIERDPIYAAKLEALRA
LHAVNPTAERREAFAAYRATEGQGLVDFAEWCARQDDDHADDLVDFYMWLQFLCDEQLAA
AQRRAVDAGMAVGVVTDLAVGVHPGGADAHNLAPWLAADASVGAPPDGYNQQGQDWSQPP
WNPAELAAAGYEPWREMINTVLRHAGGVRADHILGLFRLFWMPRMQHPSTGTYVNYDYEA
MVGVLTLEAERAGAVVIGEDLGTFEPWVQDVLTSRGVLGTSVLWFESSDREDGPRHQDEY
RQLALSAVGTHDLPPTAGYLVGEHIRLRDELGLLTTDAADEETEDLRWQGQVLDRVRQAG
GFEGTAAQDTTFTGLARGQRGDVADLLVGLHRFMAGTPSALTVTNLVDLVGDVQIQNQPG
TNSEQHPNWRLPLADGAGKVVLIEDLADNELFRRVGAASRRG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgactcatctggatgcgctcaatgaactggcgaaggcctacggcctcgccccctcgtac
accgacagcagtggcacgaccgtcaccgcgacggccgacacgttggtcaaactgctccgc
gccatgggcgtggacttgggtgaggccgaagaacccgctgagtcggacattcaggccgcc
caacagaccatgcgcgaggagctggccacccggccgctgccgctgacggtggcggccgtc
gaaggcgacgccgccaccttcgacgtgcacgtgcaccacggctcccccgccgaggtcgcg
atcgtctgcgaggacggcacccgccgcgaggtcacccaggaacacaactggcgccaaccg
gtgaccgtggcgggcaccacctggggcgaggcgaccttccgcctgcccgccgacctgccg
accggctaccacaccatcaccttgacctccggcgagctggaggccagcacccggctgatc
gtctcccccgcccggctgaccaccgcggacgcctacctctccgaacgccgcttcggggtc
atggcccagctgtactcggtgcgctccgaagcctcctggggcatcggcgacttccgcgac
ctggggctgctggcgaagaccgtcgccacggagatcggcgcggacttcctgctggtcaac
ccgctgcacgccgccgagccggtcccgccggtggaggactcgccctacctgccgaccacc
cggcgcttcaccaacccgatctacctgcacgtcgaggacgtccccgagtacacgcaggcc
gacgagaaggtccgcgcgcagatcgacgccgccgccaagcgcttccacccgcgcaaccgt
tccggcgaagtcatcgaacgcgacccgatctacgccgccaaactcgaggcgctgcgggcg
ctgcacgccgtgaatcccaccgccgaacgccgggaggccttcgccgcctaccgcgcgacc
gagggccagggcctggtcgacttcgccgagtggtgcgcccgacaagacgacgaccacgca
gacgacctcgtcgacttctacatgtggctgcagtttctgtgcgacgaacaactcgccgcc
gcccagcgacgcgccgtcgacgccggcatggccgtcggcgtggtcaccgacctggccgtg
ggcgtgcacccgggcggcgccgacgcccacaacctcgccccctggctcgcggccgacgcc
tccgtgggtgccccgccggacggttacaaccagcagggccaggactggtcgcagccgccg
tggaaccccgcggaactggccgccgccggctacgaaccgtggcgggagatgatcaacacc
gtgctgcggcatgccggcggcgtgcgcgccgaccacatcctcggcctgttccgactgttc
tggatgccgcgcatgcagcacccctccacgggcacctacgtcaactacgactacgaggcc
atggtcggcgtgctgaccctggaggccgagcgcgccggggccgtggtcatcggcgaggac
ctgggcaccttcgaaccctgggtgcaggacgtgctgacctcgcgcggggtgctgggcacc
tccgtgctgtggttcgagtccagcgaccgggaggacggcccccgccaccaggacgaatac
cgccaactggcgctgtccgcggtgggcacccacgacctgccgccgacggccggctacctg
gtcggcgagcacatccggctgcgcgacgagctgggcctgctcaccaccgacgcggccgac
gaagaaacagaggacctgcgctggcagggccaggtcctggaccgggtgcggcaggccggt
ggcttcgagggcaccgccgcgcaggacacgacgttcaccggtctggcgcgcgggcagcgc
ggcgacgtcgccgacctgctcgtcggcctgcaccgcttcatggccggcaccccctcggcg
ctgaccgtgaccaacctggtcgacctggtcggcgacgtgcagatccaaaaccagccgggc
accaactccgaacagcacccgaactggcgcctcccgctggccgacggcgccgggaaggtc
gtcctcatcgaggacctcgcggacaacgagttgttccgccgggtcggcgccgcttcccga
cgcggctaa

DBGET integrated database retrieval system