KEGG   Corynebacterium maris: B841_09830Help
Entry
B841_09830        CDS       T02784                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cmd  Corynebacterium maris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cmd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2136868..2138700
Genome map
AA seq 610 aa AA seqDB search
MDSPEPPVNPDENPTHPLAENTDEEAPVPRPATDAEGYVIEHESEEYETPTPAPGDNPWE
RPEHDWYKDAVFYEVLVRAFYDPEGSGSGTLKGVTEKLDYLQWLGIDCIWLPPFFDSPLR
DGGYDIRNFREVLPEFGTVDDFVELMDQAHRRGIRVLTDLVMNHTSDQHAWFQESRHDPE
GPYGDFYVWSDDPTLYSEARIIFVDTEDSNWTWDPVRKQYFWHRFFSHQPDLNYDNPEVQ
EAMLDVMRFWLDLGLDGLRLDAVPYLYEREGTNGENLPETHAFLKEVRAVIDEEYPGRML
LAEANQMPEEVVEYFGEPDRGDECHMAFHFPVMPRIFMSLDQESRTPISEILKETPHIPK
TAQWGMFLRNHDELTLEMVSDEERDYMYSTYAKDPRMKANVGIRRRLTPLLNGNRNKVEL
LTGLLLSLPGSPFLYYGDEIGMGDNIWLSDRDGVRTPMQWSSDRNGGFSRADPERLYLPA
IMNDQYGYSTVNVENQMRRENSMLHWTREHVLVRKQYKAFGRGTYREVPSGNEHVLAFLR
EHKGEAILCVNNFSSRPQAVKLDVSEFEGVTPRELTGGELFPEVKHYPITVTLPPHGFFW
YDMSGEDNDD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggacagccctgaaccgccggtgaacccggatgagaatccgacgcatcctctggccgaa
aacacggatgaggaggcgccggttcctcgtccggcgacggacgcggaaggttatgtgatc
gagcatgagtcggaggagtatgagactccgactcctgcccccggtgacaacccgtgggag
cgcccggaacacgactggtacaaggacgccgtgttttatgaggtgttggtgcgtgccttt
tacgatccggagggcagtggctccggcacgttgaagggtgtgacggagaagctcgattat
ctgcagtggttgggcatcgactgcatctggttgccgccgtttttcgattcccccctgcgt
gacggcgggtacgacatccgtaatttccgtgaggtgttgccggagttcggcacggtcgac
gacttcgtcgagttgatggaccaggctcaccgtcgaggcatccgcgtgctcacggatctg
gtgatgaaccacacgtccgatcagcacgcgtggttccaggagtcgcgccatgatccggag
ggcccgtacggggacttttatgtgtggtcggatgacccgacactctattccgaggcccgc
atcatcttcgtggacaccgaggattcgaactggacgtgggacccggtgcgcaagcagtac
ttctggcaccgtttcttctcgcatcagccggatctgaattacgacaacccggaagtgcag
gaggcgatgctcgacgtcatgcgcttctggctggatctggggttggacgggctgcgtctg
gacgcggtgccctacctgtacgagcgggaaggcaccaacggcgagaacttgccggagacc
cacgcgttcctcaaggaggttcgtgcggtcattgacgaggagtacccggggcgcatgctg
ctggcggaggccaaccagatgccggaggaggtcgtcgagtacttcggcgagccggaccgc
ggcgacgagtgccacatggcgttccacttcccggtgatgccgcggatcttcatgtctttg
gatcaggagtcgcgtactccgatttcggagattttgaaggagacgccgcacatcccgaag
acggcgcagtggggcatgttcctgcgtaaccacgatgagctgacgctcgagatggtctcg
gacgaagaacgcgactacatgtactcgacgtatgcgaaggacccgcggatgaaggcgaac
gtgggcatccgccgccgtctgaccccgctgctcaacggcaaccgcaacaaggtggagctg
ctgaccgggttgctgttgtcgctgccaggatcgccgttcctgtactacggcgatgagatc
ggcatgggcgacaacatctggctcagcgaccgcgacggggtgcgcaccccgatgcagtgg
tcctcggaccgcaacggcggtttctcccgggcggatccggagcggctgtacctgccggcg
atcatgaacgatcagtacggctactccaccgtcaacgtggaaaatcaaatgcggcgcgag
aactccatgctgcactggacgcgcgagcacgtgctggtgcgtaagcagtacaaggctttc
ggccgcggcacctaccgggaggtgccgtcgggcaacgagcatgtgctggctttcctccgc
gaacacaagggcgaagcgatcctgtgcgtgaacaacttctcctcgcgcccgcaggcagtg
aagctggatgtctcggagtttgagggtgtcaccccgcgggagctgacgggcggcgagctg
ttcccggaggttaagcattaccccatcacggtgactctgcctccgcacggtttcttctgg
tacgacatgagcggcgaggacaacgatgactaa

DBGET integrated database retrieval system